KEGG   Streptomyces avermitilis: SAVERM_1934Help
Entry
SAVERM_1934       CDS       T00126                                 

Gene name
alkA1
Definition
(GenBank) putative ADA-like regulatory protein
  KO
K13529  AraC family transcriptional regulator, regulatory protein of adaptative response / DNA-3-methyladenine glycosylase II [EC:3.2.2.21]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_1934 (alkA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sma03000]
    SAVERM_1934 (alkA1)
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_1934 (alkA1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     SAVERM_1934 (alkA1)
Transcription factors [BR:sma03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    SAVERM_1934 (alkA1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_1934 (alkA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AlkA_N Ada_Zn_binding HTH_18 HhH-GPD HTH_AraC
Motif
Other DBs
NCBI-ProteinID: BAC69645
NITE: SAV1934
UniProt: Q82LS6
Position
complement(2364468..2365934)
Genome map
AA seq 488 aa AA seqDB search
MHIDSERCVRAVRSKDARFDGWFFTAVLTTRIYCRPSCPVVPPKPANMTFYPSAAACQQA
GFRACKRCRPDTSPGSPEWNQRADLVARAMRLIGDGVVDREGVPGLATRLGYSTRQIERQ
LLAELGAGPLALARAQRAQTARLLIETTSLPMAEIAFAAGFSSIRTFNDTVREVFALSPS
ELRGRLPKKTVVSPGALTLRLPFRAPLNPDNLFGHLAATAVPGVEEWRDGAYRRTLRLPY
GHGIVALTPAADHIGCRLSLSDLRDLPVAISRCRRMLDLDADPVAIDDQLRADPLLAPLV
DKAPGRRVPRTVDEAEFAVRAVLGQQVSTAAARTHAARLVTAHGEAVTDPEGGLTHLFPA
PEALAAVAPESLAMPRTRRTTFTTLVRQLAEGGLHLGVESDWEETRARLLSLPGFGPWTA
DVIAMRALGDPDAFLPTDLGIRRAAEELGLPSTPAALTARAAAWRPWRAYAVQYLWATDS
HPINFLPV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcacatcgacagtgagcgctgcgtgcgcgccgtccggtccaaggacgcgcggttcgac
gggtggttcttcacggcggtcctgaccacgaggatctactgccgtccgagctgcccggtg
gtgccgccgaagccggcgaacatgacgttctacccgagcgcggcggcctgccagcaggcc
ggtttccgggcctgcaaacgctgccgcccggacaccagccccggctcgcccgagtggaac
cagcgcgccgacctcgtcgcccgcgccatgcgcctgatcggcgacggcgtggtggaccgc
gagggcgtgcccggcctcgccacccggctcggctacagcacccgccagatcgaacgccag
ctcctcgccgaactcggcgcgggcccgctcgcgctcgcccgggcccagcgcgcccagacc
gcccgcctgctcatcgagacgaccagcctccccatggcggagatcgccttcgcggcgggc
ttctcctcgatccgcaccttcaacgacaccgtgcgcgaggtcttcgccctctccccgagc
gagctgcgcggcaggctcccgaagaagacggtcgtgtcccccggcgctctcacgctccgc
ctccccttccgcgccccgctcaaccccgacaacctcttcggccacctcgcggcgaccgcc
gtacccggagtggaggaatggcgggacggcgcgtaccggcgcaccctgcgcctgccgtac
gggcacgggatcgtcgccctgacccccgccgccgaccacatagggtgccgcctctccctc
agcgacctgcgcgacctgcccgtcgccatcagccgctgccgccgcatgctcgacctggac
gccgacccggtcgccatcgacgaccagttgcgcgccgacccgctgctcgccccgctcgtc
gacaaggcgccggggcggcgggtgccgcgtaccgtcgacgaggccgagttcgcggtacgg
gccgtgctgggccagcaggtgtccacggccgcggcccgtacccacgcggcccgcctggtc
accgcgcacggcgaagcggtgaccgaccccgaggggggcctcacccacctcttcccggcc
cccgaggcgctggccgccgtcgcccccgagtcgctcgcgatgccccgtacccgccgcacc
accttcaccacgctggtccgccaactggccgagggcggacttcatctgggcgtggagagc
gactgggaggagacccgcgcccggctcctgtccctccccggcttcggcccctggaccgcg
gacgtcatcgcgatgcgcgccctcggcgaccccgacgcgttcctgcccaccgacctcgga
atccggcgcgcggccgaggagttgggcctgccgtccacaccggccgcgctcaccgcacgc
gcggcggcctggcggccgtggcgggcgtacgcggtccagtacctgtgggcgacggacagc
cacccgatcaacttcctgccggtgtga

DBGET integrated database retrieval system