KEGG   Streptomyces avermitilis: SAVERM_2450Help
Entry
SAVERM_2450       CDS       T00126                                 

Definition
(GenBank) putative ATP-dependent DNA helicase
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:3.6.4.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_2450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2450
Enzymes [BR:sma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SAVERM_2450
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SAVERM_2450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C ResIII RecQ_Zn_bind AAA_30 Pribosyltran AAA_22
Motif
Other DBs
NCBI-ProteinID: BAC70161
NITE: SAV2450
UniProt: Q82KF3
Position
2987332..2989536
Genome map
AA seq 734 aa AA seqDB search
MSDEDQRPAPSADPRPAPDGDLRTAADAVLARLVGAPTGEARLREDQWRAIEALVAHKRR
ALVVQRTGWGKSAVYFVATALLREQGAGPTVIVSPLLALMRNQVDSAARAGIRARTINSS
NTEEWDTIQAEVAASEVDVLLVSPERLNNPDFRDQVLPKLAAATGLLVVDEAHCISDWGH
DFRPDYRRLRTMLADLPSGVPVLATTATANARVTADVAEQLGTGGGTDALVLRGPLDRES
LSLGVLRLPDAAHRMGWLAEHLNDLPGSGIIYTLTVAAAEEVTAFLRQCGHTVASYTGKT
ENADRLQAEEDLLGNRVKALVATSALGMGFDKPDLGFVVHLGSPSSPIAYYQQVGRAGRG
VEHAEVLLLPGKEDQAIWEYFASVAFPPEEQVRRTLDVLARADRPLSLPALEPLVELRRS
RLETMLKVLDVDGAVRRVQGGWVSTGVPWTYDTERYAWVAKQRSAEQQAMRDYVTTTACR
MEFLRRQLDDEGAAPCGRCDNCAGGRFHDSVSSGSLDAARGELGRAGVEVEPRKMWPTGL
PAVGVDLKGRIPAGELAAPGRALGRLSDIGWGNRLRPMLTPQAPDGPVPDDVAKAVVGVL
ADWAKGPGGWASAGPDAQPRPVGVVTMASRTRPQLIQSLGARIAEIGRLPLLGSIEYTGE
FAQVHRSNSAQRLKALDGALTVPPALATALKEAGGPVLLVDDATETGWTLAVAARMLRRA
GASGVLPLVLAVQA
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgaagaccaacgacccgccccgtccgcagacccgcgccccgccccggacgga
gacctgcgtaccgcggccgatgccgtgctcgcccgcctcgtgggcgcgccgacgggcgag
gcccggctgcgcgaggatcagtggcgggccatcgaggcactggtggcccacaagcgcagg
gccctggtcgtgcagcgcacgggctggggcaagtccgcggtgtacttcgtcgcgaccgcg
ttgctgcgcgagcagggcgcgggtcccacggtcatcgtctcgccactcctcgcgctcatg
cgcaaccaggtggattcggcggcccgcgcgggcatccgcgcgaggaccatcaactcgtcc
aacacggaggagtgggacacgatccaggccgaggtggccgcgagcgaggtcgatgtgctc
ctggtgagcccggagcggctcaacaaccccgacttccgcgaccaggtgctgcccaagctg
gccgccgcgaccggcctcctcgtggtcgacgaggcgcactgcatctccgactggggccac
gacttccggcccgactaccgccggctgcgcaccatgctcgccgacctcccgtccggtgtg
ccggtcctcgccaccaccgcgacggccaacgcgcgcgtcacggccgacgtggccgaacaa
ctcggcaccggaggcggcacggacgcgctcgtgctgcgcggaccgctcgaccgggagagc
ctcagtctcggcgtgctgcgcctgccggacgccgcccaccgcatgggctggctcgccgaa
cacctcaacgacctgccgggctccggcatcatctacacgctcaccgtggctgcggccgag
gaagtcacggccttcctgcgtcagtgcgggcacaccgtggcctcgtacaccggcaagacg
gagaacgcggaccggctacaagcggaggaggacctgctcggcaaccgggtcaaggccctg
gtagccacgtccgccctgggtatgggcttcgacaagcccgacctcgggttcgtcgtccac
ctcggctcgccctcgtcccccatcgcgtactaccagcaggtggggcgcgcgggccgcggt
gtggagcacgccgaggtgctgctcctgccgggcaaggaggatcaggcgatctgggagtac
ttcgcctcggtcgcgtttcccccggaggagcaggtgcgacgcacactggacgtcctggcg
cgggccgaccgaccactgtccctgcccgccctcgaaccgctggtcgaactgcgccgctca
cgtctggagacgatgctcaaggtcctcgatgtcgacggggccgtacggcgtgtgcagggc
ggctgggtctcgacgggcgttccttggacgtacgacaccgagcgctacgcctgggtggcc
aagcagcggtcggctgagcagcaggcgatgcgcgactacgtgacgacgacggcctgccgg
atggagttcctgcggcggcagctcgacgacgagggggcggctccctgtgggcgctgcgac
aactgcgccggaggccgattccacgactccgtgtcgtccgggtcgctcgacgcggcacgt
ggcgaactcgggcgtgcgggcgtcgaggtcgagccccggaagatgtggccgacgggcctg
ccggcggtcggcgtcgacctgaaggggcgtatcccggccggagagctggccgcgcccggg
cgtgcgctggggcggctgtcggacatcggctggggcaaccggctgcggccgatgctcacg
ccccaagccccggacgggccggtgccggacgatgtcgccaaggccgtggtcggtgtgctg
gccgactgggcgaaggggccgggaggctgggcctccgcagggcccgacgcacagccgcgt
ccggtgggcgtcgtcacgatggcctcccgtacgcgtccgcagctgatccagtccctgggg
gcgcggatcgcggagatcggacggctgccgctgctggggtccatcgagtacaccggtgag
ttcgcgcaggtccaccggagcaacagcgcgcagcggctgaaggcgctcgacggggcactg
accgtgccgcccgccctggccaccgcgctcaaggaagccggcggtccggtacttctcgtg
gacgatgcgacagagacgggctggaccctcgcggtggccgcgcgcatgcttcgacgagcc
ggtgcgtcgggggtgttgccgctggtcctggccgtacaagcgtga

KEGG   Streptomyces avermitilis: SAVERM_4851Help
Entry
SAVERM_4851       CDS       T00126                                 

Gene name
recQ
Definition
(GenBank) putative ATP-dependent DNA helicase
  KO
K03654  ATP-dependent DNA helicase RecQ [EC:3.6.4.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    SAVERM_4851 (recQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_4851 (recQ)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SAVERM_4851 (recQ)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SAVERM_4851 (recQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RQC HRDC Helicase_C RecQ_Zn_bind DEAD
Motif
Other DBs
NCBI-ProteinID: BAC72563
NITE: SAV4851
UniProt: Q82DW7
Position
5896755..5898731
Genome map
AA seq 658 aa AA seqDB search
MSTAEALDESEALTTLHRVFGYEAFRGEQEAVIEHVVAGGDAVVLMPTGGGKSLCYQIPA
LVRPGTGVVVSPLIALMQDQVDALRALGVRAGFINSTQDFDERRTMEAAFLAGELDLLYL
APERLRLEGTLDLLSRGKISVFAIDEAHCVSQWGHDFRPDYLALSLLGERWPDVPRLALT
ATATHATHQEITQRLGMPTARHFVASFDRPNIQYRIVPKADPKKQLLSFLSDEHAGDAGI
VYCLSRNSVEKTAEFLSRNGIEAVPYHAGLDAGTRAAHQSRFLREEGLVVVATIAFGMGI
DKPDVRFVAHLDLPKSVEGYYQETGRAGRDGLPSTAWMAYGLNDVIQQRKLIQGGEGDEA
FRRRAAAHLDAMLGLCETAQCRRGQLLAYFGQDPQSGGCGNCDTCLVPPDTWDGTIAAQK
VLSTVWRLERERRQKFGAVQIIDILLGRRTAKVIQFDHDQLSVFGIGEELTEGEWRGVVR
QILAQGLLAVEGEYGTLVLTEASGTVLRREREVPLRKDPPKPTASRSSAGSGAGSAKGER
KPKAAVAELSPELQPAFEALRAWRAEQAREQGVPAYVIFHDATLREIVTAWPSSVAELGT
ISGVGEKKLATYGEGVLGALAALGGTPGDDTQKSPTAEAEPAPDWPEMDEEPEPEEWM
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggcggaggcactggacgagagcgaggcgctgaccacgcttcaccgcgtcttc
gggtacgaggccttccgcggtgagcaggaagcggtcatcgagcacgtggtggccggcggc
gacgcggtcgtcctcatgccgaccggcggcggcaagtcgctgtgctaccagatcccggcc
ctggtcagacccggtacgggggtggtcgtctcgcccctcatcgcgctgatgcaggaccag
gtggacgcgctgcgggcgctgggcgtgcgcgccgggttcatcaactcgacgcaggacttc
gacgagcggcgcacgatggaggccgcgttcctggccggggagctggacctgctctacctg
gctccggagcgcctgcggctggaagggaccctcgatctgctctcacgcggcaagatctcg
gtcttcgccatcgacgaggcgcactgtgtgtcgcagtggggtcacgacttccgccccgac
tatctggcgctgtcgctgctgggcgagcggtggccggacgtgccgcggctcgcgctcacg
gcgacggccacgcacgcgacgcaccaggagatcacccagcgcctgggcatgccgaccgcc
cggcacttcgtggcgagcttcgaccgccccaacatccagtaccggatcgtgcccaaggcc
gaccccaagaagcagctgctgtccttcctgagcgacgagcacgcgggcgacgcgggcatc
gtctactgcctctcgcggaactcggtggagaagacggccgagttcctctcccgcaacggt
atcgaggcggtgccgtaccacgcgggcctggacgcgggcacccgtgcggcccaccagtcc
cgcttcctgcgtgaggaaggcctcgtcgtggtcgcgacgatcgccttcggcatgggcatc
gacaagccggacgtgcggttcgtcgcccacctcgacctgccgaagtccgtcgagggctac
taccaggagacaggccgtgcgggccgcgacggactgccgtccacggcctggatggcctac
gggctgaacgacgtcatacaacagcggaagctgatccagggcggcgagggcgacgaggcg
ttccggcgccgggccgccgcccacctggacgcgatgctggggctgtgcgagacggcacag
tgccgccgcggccagctgctcgcctacttcggccaggacccgcagtccggcggctgcggc
aactgcgacacatgcctcgtgccgcccgacacctgggacggcacgatcgcggcgcagaag
gtgctgtccacggtgtggcgcctggagcgggagcgacgccagaagttcggtgcggtgcag
atcatcgacatcctgctggggcggcgcacggcgaaggtgatccagttcgaccacgaccag
ctgtccgtgttcggcatcggcgaggagctgaccgaaggagaatggcgcggagtcgtacgg
cagatactggcgcaggggctgctcgcggtcgagggcgagtacgggacgctggtgctgacg
gaggcgagcgggacggtgctgcggcgcgagcgggaggtgccgctgcgcaaggatccgccg
aagccgacggcatcccggtcctcggcgggctccggcgcgggctccgccaagggcgagcgc
aagccgaaggcggccgtggccgagctctcgccggaacttcagccggccttcgaggccctg
cgcgcctggcgcgccgagcaggcgcgcgagcagggcgtcccggcgtacgtcatcttccac
gacgccacgctccgggagatcgtcacggcgtggccgtcctcggtggcggagctgggcacc
atcagcggggtgggcgagaagaagctggcgacgtacggggagggcgtgctgggggcactc
gccgcgctgggcgggacacccggtgatgacacccagaagtccccgacggccgaagccgag
ccggctccggactggcccgagatggacgaggaaccggagccggaggagtggatgtag

DBGET integrated database retrieval system