KEGG   Streptomyces avermitilis: SAVERM_2492Help
Entry
SAVERM_2492       CDS       T00126                                 

Gene name
recA
Definition
(GenBank) putative recombination protein RecA
  KO
K03553  recombination protein RecA
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_2492 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2492 (recA)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAVERM_2492 (recA)
    RecFOR pathway proteins
     SAVERM_2492 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    SAVERM_2492 (recA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecA ATPase Rad51 ATPase_2 AAA_25 AAA_24 AAA_16 CobU CbiA DnaB_C AAA AAA_14 AAA_35
Motif
Other DBs
NCBI-ProteinID: BAC70203
NITE: SAV2492
UniProt: Q82KB1
Position
complement(3039751..3040884)
Genome map
AA seq 377 aa AA seqDB search
MAGTDREKALDAALAQIERQFGKGAVMRLGERPNEPIEVIPTGSTALDVALGVGGLPRGR
VVEVYGPESSGKTTLTLHAVANAQKAGGQVAFVDAEHALDPEYAKKLGVDIDNLILSQPD
NGEQALEIVDMLVRSGALDLIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKITS
ALNQSKTTAIFINQLREKIGVMFGSPETTTGGRALKFYASVRLDIRRIETLKDGTDAVGN
RTRVKVVKNKVAPPFKQAEFDILYGQGISREGGLIDMGVENGFVRKAGAWYTYEGDQLGQ
GKENARNFLKDNPDLANEIEKKIKEKLGVGVRPEEPTAEPGADAAVTSAAAATDDTAKTV
SAPAAKTTKSKAAAAKS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaccgaccgcgagaaggcgctcgacgccgcgctcgcacagattgaacggcaa
ttcggcaagggcgcggtgatgcgcctgggcgagcggccgaatgagcccatcgaggtcatc
cccaccgggtcgaccgcgctcgacgtcgccctcggcgtcggcggcctgccgcgcggccga
gtggtggaggtgtacggcccggagtcctccggtaagacgaccctgacgctgcacgcggtg
gcgaacgcgcagaaggccggcggccaggtggccttcgtggacgccgagcacgccctcgac
cccgagtacgcgaagaagctcggcgtcgacatcgacaacctgatcctgtcgcagccggac
aacggtgagcaggctctggagatcgtggacatgctggtccgctccggcgcgctcgacctg
atcgtcatcgactccgtcgccgccctggtgccgcgcgcggagatcgagggcgagatgggc
gactcgcacgtgggtctgcaggcccgcctgatgagccaggccttgcggaagatcaccagc
gcgctcaaccagtcgaagaccaccgcgatcttcatcaaccagctccgcgagaagatcggc
gtgatgttcggctctccggagaccacgacgggtggccgggcgctgaagttctacgcctcg
gtgcggctcgacatccgtcgcatcgagacgctgaaggacggcaccgacgcggtcggcaac
cgcacccgcgtcaaggtcgtcaagaacaaggtcgcgccgcccttcaagcaggccgagttc
gacatcctctacgggcagggcatcagccgcgaaggcggcctgatcgacatgggcgtggag
aacggcttcgtccgcaaggctggcgcctggtacacgtacgagggcgaccagctcggccag
ggcaaggagaacgcgcgcaacttcctgaaggacaaccccgacctcgccaacgagatcgag
aagaagatcaaggagaagctgggcgtcggcgtacggccggaggagcccacggcggagccg
ggcgcggacgcggcggtcacgtcggccgcggctgccacggacgacaccgcgaagacggtg
tccgctcccgcggccaagaccaccaagtccaaggccgcggcggccaagagctag

DBGET integrated database retrieval system