KEGG   Streptomyces avermitilis: SAVERM_2565Help
Entry
SAVERM_2565       CDS       T00126                                 

Gene name
secA2
Definition
(GenBank) putative preprotein translocase SecA subunit
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_2565 (secA2)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_2565 (secA2)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_2565 (secA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_2565 (secA2)
Enzymes [BR:sma01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     SAVERM_2565 (secA2)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_2565 (secA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind DEAD Helicase_C DUF4292 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: BAC70276
NITE: SAV2565
UniProt: Q82K39
Position
complement(3144985..3147747)
Genome map
AA seq 920 aa AA seqDB search
MPVLGLDNITGRIMRAGEGRILRRLQRIAAQVNSLEEEFKALTDEELQALTPEFTRRHAD
GESLDDLLPEAFATMREAARRTLGMRHFDVQLMGGAALHFGNIAEMQTGEGKTLVGTLPV
YLNALTGKGVHLVTVNDYLAERDAEWMGRAYRFLGLTVGVIKSQSTPAERRAQYACDITY
GTNTEFGFDYLRDNMAWSQDELVQRGHHFAIVDEADSILIDEARTPLIISGPADQPTQWY
GAFAKLVTRMRGVRVQEEQFVTPADKDRLAHLRTTHDYEYDPKKRTVAILDRGVEYLQDQ
LGIESLYESEHTSLIGHLNNALKAKEHFRKDKDYVVVDGEVLIVDEHTGRILAGRRYNEG
LHQAIEAKEAEEGTEAGVTVRNENQTLATITLQNFFRLYEKLAGMTGTAMTEAAEFHQIY
QLNVVPIPSNRPMIRRDDPDQIYRTEEAKYAAILADIAERHETGQPILVGTTSVEKSELL
SGLLRKQGIRHEVLNAKNHQREAQIVAQAGRRGAVTVATNMAGRGTDIMLGGNPEAMALA
ALPEDATPEDREAVLDRVGRAAAAEHEEVKELGGLYVLGTERHESRRIDNQLRGRSGRQG
DPGASRFYLSLGDDLMRLFRAQVVERVMSMANVPDDVPIENKMVTRAIASAQSQLEQQHF
ESRKDVLKFDEVLNRQRTLIYAERRRVLAGEDLREQVRHFMDDTIEAYIRQETGEGFPEE
WDLERLWGAFRQLYPVGITIEDLEDSVGGRPDLTVDDLVAAVTEDVHDRYARREAELGAD
ALRDLERLVVLSVLDRKWREHLYEMDYLRDGIGLRWTLGREPIVEYEREGFDMFGAMTEA
IKEESVGYVFNLDATGREGEGSALDRRPTDGLHFSAPTLDTAEGVVEGRFTTAPAGEPAE
HDKAPPHRPGKSRNRRRRKR
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgccggttctcggtctcgacaacatcaccggcaggatcatgcgggccggtgaagggcga
atcctgcgccgtttgcagcgcatcgcggcacaggtgaactccctggaggaagaattcaag
gcgctgaccgacgaggaactccaggcactcactcccgagttcacccggcgccacgccgac
ggcgagagcctcgacgacctgctgcccgaggccttcgccacgatgcgcgaggcggcccgg
cgcaccctcggcatgcgtcacttcgacgtccagctcatgggcggcgcggcgctccacttc
ggcaacatcgcggagatgcagaccggcgagggcaaaaccctggtcggcaccctgcccgtc
tatctgaacgccctgaccggcaagggggtccacctcgtcacggtcaacgactacctcgcc
gagcgcgacgccgagtggatgggacgggcgtaccgcttcctgggcctgaccgtcggcgtc
atcaagtcacagtcgacgcccgccgagcggcgcgcgcagtacgcctgcgacatcacctac
ggcaccaacaccgagttcggcttcgactatctgcgcgacaacatggcctggtcgcaggac
gaactcgtccagcgcggccaccacttcgccatcgtcgacgaggccgactcgatcctcatc
gacgaggcccgcacgcccctgatcatctcgggcccggccgaccagcccacccagtggtac
ggggccttcgccaagctggtcacgcggatgcggggcgtacgggtccaggaggagcagttc
gtcaccccggccgacaaggaccgcctcgcccatctgcggaccacccacgactacgagtac
gacccgaagaagcgcaccgtggcgatcctggaccgcggtgtcgagtacctccaggaccag
ctcggcatcgagagcctgtacgagtccgagcacacctcgctgatcgggcatctcaacaac
gccctcaaggccaaggagcacttcaggaaggacaaggactacgtcgtcgtggacggcgag
gtactgatcgtcgacgagcacacgggccgcatcctggccggccgccgctacaacgagggg
ctgcaccaggcgatcgaggcgaaggaggcggaggagggcacggaggcgggagtgacggtc
aggaacgagaaccagaccctggccacgatcaccctgcagaacttcttccgcctctacgag
aaactcgcgggcatgaccggcacggcgatgaccgaggccgccgagttccaccagatctac
cagttgaacgtcgtgccgatcccgagcaaccggcccatgatccgccgcgacgaccccgac
cagatctaccgcaccgaggaggcgaagtacgccgcgatcctcgccgacatcgccgaacgg
cacgagaccggccagccgatcctcgtcggcaccacctccgtggagaagtccgagctgctg
tccggcctgctgcggaagcagggcatccggcacgaggtcctcaacgccaagaaccaccag
cgcgaggcccagatcgtcgcccaggccggccgcaggggcgccgtcaccgtcgccaccaac
atggccggccgcggcaccgacatcatgctcggcggcaaccccgaggcgatggcgctcgcc
gcgctccccgaagacgccacgccggaggaccgcgaggccgtactcgaccgcgtcggcagg
gcggccgccgccgagcacgaggaggtcaaggaactcggcggcctctacgtcctgggcacc
gagcgccatgagtcgcgccgcatcgacaaccagctgcgcggccgctccggccggcagggc
gaccccggcgcctcccgcttctacctctccctcggggacgacctgatgcggctgttccgc
gcccaggtcgtcgagcgggtgatgtcgatggcgaacgtgcccgacgacgtcccgatcgag
aacaagatggtcacccgcgccatcgcctccgcccagtcccagctggaacagcagcacttc
gagtcccgcaaggacgtcctgaagttcgacgaggtcctcaaccgccagcgcaccctgatc
tacgccgagcgccgccgcgtcctggccggtgaggacctgcgcgagcaggtccggcacttc
atggacgacaccatcgaggcgtacatccggcaggagaccggcgagggcttccccgaggag
tgggacctggagcggctgtggggagccttcaggcagctctacccggtcggcatcaccatc
gaggacctggaggactccgtcggcggccggcccgacctcacagtcgacgacctcgtggcg
gcggtcaccgaggacgtccacgaccgctacgcgcggcgcgaggcggaactcggcgccgac
gccctgcgcgacctggaacgcctcgtcgtgctctccgtcctcgaccgcaaatggcgcgag
cacctctacgagatggactacctgcgcgacggcatcggcctgcgctggacgctgggccgc
gagccgatcgtcgagtacgagcgcgagggcttcgacatgttcggcgcgatgaccgaggcg
atcaaggaggagtccgtcggatacgtgttcaacctggacgccacgggccgggagggggag
ggctccgccctggaccgccgccccaccgacggactgcacttcagcgcgccgacgctggac
accgcggagggcgtggtcgagggccgcttcacgacggcgcccgccggggaaccggccgag
cacgacaaagcgccgccgcaccggcccgggaagtcccggaaccggcggcggcgcaagagg
tag

KEGG   Streptomyces avermitilis: SAVERM_5071Help
Entry
SAVERM_5071       CDS       T00126                                 

Gene name
secA1
Definition
(GenBank) putative preprotein translocase SecA subunit
  KO
K03070  preprotein translocase subunit SecA [EC:7.4.2.8]
Organism
sma  Streptomyces avermitilis
Pathway
sma02024  Quorum sensing
sma03060  Protein export
sma03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    SAVERM_5071 (secA1)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SAVERM_5071 (secA1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    SAVERM_5071 (secA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sma02044]
    SAVERM_5071 (secA1)
Enzymes [BR:sma01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     SAVERM_5071 (secA1)
Secretion system [BR:sma02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   SAVERM_5071 (secA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecA_DEAD SecA_SW SecA_PP_bind DEAD Helicase_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: BAC72783
NITE: SAV5071
UniProt: Q82DB1
Position
6146233..6149052
Genome map
AA seq 939 aa AA seqDB search
MSVLSKIMRAGEGKILRKLHRIADQVNSIEEDFVDLSDAELRALTDEYKQRYADGESLDD
LLPEAFATVREAAKRVLGQRHYDVQMMGGAALHLGYVAEMKTGEGKTLVGTLPAYLNALS
GDGVHLITVNDYLAERDSEMMGRVHKFLGLSVGCILANMTPAQRREQYGCDITYGTNNEF
GFDYLRDNMAWSQDELVQRGHNFAVVDEVDSILVDEARTPLIISGPADQATKWYGDFAKL
VTRLKKGEAGNTLKGIEETGDYEVDEKKRTVAIHESGVAKVEDWLGIDNLYESVNTPLVG
YLNNAIKAKELFKKDKDYVVIDGEVMIVDEHTGRILAGRRYNEGMHQAIEAKEGVDIKDE
NQTLATITLQNFFRLYNKLSGMTGTAMTEAAEFHQIYKLGVVPIPTNKPMVRKDQSDLIY
RTEVAKFDAVVDDIAEKHEKGQPILVGTTSVEKSEYLSQQLSKRGIQHEVLNAKQHDREA
TIVAQAGRKGAVTVATNMAGRGTDIKLGGNPDDLAEAELRQRGLDPEEHIEEWAAALPAA
LERAEKAVKAEFEEVKELGGLYVLGTERHESRRIDNQLRGRSGRQGDPGESRFYLSLGDD
LMRLFKAQMVERVMSMANVPDDVPIENKMVTRAIASAQSQVETQNFETRKNVLKYDEVLN
RQREVIYGERRRVLEGEDLQEQIHHFMDDTIDAYIEAETAEGFAEEWDLDRLWGAFKQLY
PVKVTVDELEEAAGDRAGLTAEFISESIKDDIHEQYEQRETQLGSEIMRELERRVVLSVL
DRKWREHLYEMDYLQEGIGLRAMAQKDPLVEYQREGFDMFTAMMDGIKEESVGYLFNLEV
QVEQQVEEVPVEDEKPSLEKEDAVPAQAGARPEIRAKGLEAPQRPDRLHFSAPTVDGEGG
IIEGDFSSDDDEEPVRSEADGLTRAERRKQSKGGRRRKK
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtcctctcaaagatcatgcgtgcaggcgaaggcaagatcctgcgcaagctgcac
cgcatcgcggaccaggtcaactccatcgaagaggacttcgtcgacctctccgacgccgag
ctgcgggccctcaccgatgagtacaagcagcggtacgccgacggcgagagcctcgacgac
ctgctgcccgaggcgttcgccaccgtccgcgaggcggccaagcgcgttctgggccagcgg
cactacgacgtgcagatgatgggcggcgccgcgctccacctcggctatgtcgccgagatg
aagaccggtgagggcaagacgctcgtcggcaccctgcccgcgtatctgaacgcgctctcc
ggagacggcgtccacctcatcacggtcaacgactacctggccgagcgcgactccgagatg
atgggccgcgtccacaagttcctgggtctgagcgtcggctgcatcctcgccaacatgacg
ccggcccagcgccgcgagcagtacgggtgcgacatcacgtacggcacgaacaacgagttc
ggcttcgactacctgcgcgacaacatggcgtggtcccaggacgaactggtgcagcgcggc
cacaacttcgcggtcgtcgacgaggtcgactccatcctcgtcgacgaggcccgtacgccg
ctgatcatctccggaccggccgaccaggccaccaagtggtacggcgacttcgccaagctg
gtcacccgcctgaagaagggcgaggcgggcaacaccctcaagggcatcgaggagaccggg
gactacgaggtcgacgagaagaagcgcaccgtcgccatccacgagtccggtgtcgccaag
gtcgaggactggctgggcatcgacaacctctacgagtcggtgaacacgccgctggtgggc
tacctgaacaacgccatcaaggccaaggagctcttcaagaaggacaaggactatgtcgtc
atcgacggcgaagtcatgatcgtcgacgagcacaccggccgtatcctcgccggccgccgc
tacaacgagggcatgcaccaggcgatcgaggcgaaggaaggggtggacatcaaggacgag
aaccagacgctcgccacgatcaccctgcagaacttcttccgcctctacaacaagctctcc
ggcatgaccggtacggcgatgaccgaggccgccgagttccaccagatctacaagctcggc
gtcgtcccgatcccgacgaacaagccgatggtccgcaaggaccagtcggacctgatctac
cgcaccgaggtggccaagttcgacgcggtggtcgacgacatcgcggagaagcacgagaag
ggccagccgatcctcgtcggcaccacctcggtcgagaagtccgagtacctctcgcagcag
ctctccaagcgcggcatccagcacgaggtgctgaacgcgaagcagcacgaccgtgaggcg
acgatcgtcgcccaggccggccgcaagggcgccgtgacggtcgccacgaacatggccggc
cgtggtacggacatcaagctcggcggcaaccccgatgacctcgccgaggcggagctgcgc
cagcgcggcctcgaccccgaggagcacatcgaggagtgggccgcggcgctgcccgccgcc
ctggagcgggccgagaaggccgtcaaggccgagttcgaagaggtcaaggaactcggcggt
ctctacgtgctgggcaccgagcgccatgagtcgcggcgtatcgacaaccagctgcgcggt
cgttccggccgccagggcgaccccggtgagtcccgcttctacctctccctgggcgacgac
ctgatgcggctgttcaaggcccagatggtcgagcgcgtgatgtcgatggcgaacgtcccc
gacgacgtgccgatcgagaacaagatggtcacgcgcgcgatcgcgtccgcccagtcgcag
gtcgagacgcagaacttcgagacccgcaagaacgtcctcaagtacgacgaggtcctcaac
cggcagcgcgaggtcatctacggcgagcgccgccgcgtcctggagggcgaggatctgcag
gagcagatccaccacttcatggacgacacgatcgacgcctacatcgaggcggagaccgcc
gagggcttcgccgaggagtgggacctcgaccggctgtggggcgccttcaagcagctctac
ccggtgaaggtcaccgttgatgagctggaggaggcggccggcgaccgtgccggtctgacg
gccgagttcatctccgagtccatcaaggacgacatccacgagcagtacgagcagcgtgag
acgcagctcggctccgagatcatgcgtgagctggagcgccgggtcgttctgtcggtcctc
gaccgcaagtggcgcgagcacctctacgagatggactatctccaggagggcatcggcctg
cgcgcgatggcgcagaaggacccgctggtcgagtaccagcgcgagggcttcgacatgttc
accgccatgatggacggcatcaaggaggagtccgtcggctacctgttcaacctggaggtc
caggtcgagcagcaggtcgaggaggtcccggtcgaggacgagaagccttcgctggagaag
gaggacgcggtgccggcgcaggcgggcgcccgtccggagatccgcgccaaggggctcgaa
gccccgcagcggccggaccggctgcacttctccgcgccgaccgtggacggcgagggcggc
atcatcgagggcgacttcagcagcgacgacgacgaagagcccgtgcggtccgaggcggac
ggcctcacgcgtgcggagcgccgcaagcagtccaagggcgggcggcgccgcaagaagtga

DBGET integrated database retrieval system