KEGG   Streptomyces avermitilis: SAVERM_2664Help
Entry
SAVERM_2664       CDS       T00126                                 

Gene name
mutM1
Definition
(GenBank) putative formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_2664 (mutM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2664 (mutM1)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SAVERM_2664 (mutM1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SAVERM_2664 (mutM1)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_2664 (mutM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS FbpA Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: BAC70375
NITE: SAV2664
UniProt: Q82JU0
Position
complement(3267410..3268270)
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEVVRRGLERWVAHRTVADVEVLHPRAVRRHTAGGEDFAHRLKGRRVGVPSRRG
KYLWLPLETTDTAVLAHLGMSGQLLVQPHDCADERHLRIRVRFADALGTELRFVDQRTFG
GLSLHDTTPDGLPDVIAHIARDPLDPLFDDAAFHEALRRKRTTVKRALLDQSLISGVGNI
YADEALWRARIHYERPTAGFTRPRTAELLGHVRDVMNAALAVGGTSFDSLYVNVNGESGY
FDRSLDAYGREGLPCRRCATPMRRRPWMNRSSYFCPKCQRAPRVTV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaattgcccgaggtcgaggttgtacggcgaggcctggagcggtgggtcgcccac
cgcaccgtcgccgatgtcgaggtgctgcacccacgtgccgtacgacgccacaccgcgggc
ggcgaggacttcgcgcaccgcctgaagggccggcgggtcggggtgccgagccgccgcgga
aagtacctctggctcccgttggagacgaccgacacggccgtcctggcgcatctcggaatg
agcggtcagctgctggtgcagccgcacgactgtgccgacgagaggcatctgcgcatccgg
gtgcgcttcgccgacgccctcggcaccgaactccgcttcgtcgaccaacgcaccttcggc
gggctctcgttgcacgacaccacgcccgacggtctgcccgacgtcatcgcgcacatcgcc
cgtgacccgctcgacccgctcttcgacgacgccgccttccacgaggcgctgcgccggaag
cgtacgaccgtcaagcgggccctgctcgaccagtcgttgatcagcggcgtcggcaacatc
tatgcggacgaggcgctgtggcgggcgcgcatccactacgagcgccccacggccggcttc
acgcgcccgcgtacggccgaactcctgggccacgtacgggatgtgatgaacgcggccctc
gccgtcggcggcaccagcttcgacagcctgtacgtcaacgtcaatggcgagtccggctac
ttcgaccgctcactcgacgcctatggacgtgaggggttgccctgccggcgctgtgccacc
ccgatgcggcgacggccgtggatgaacaggtccagctacttctgccccaagtgccagcgg
gcgccgcgcgtcaccgtgtag

KEGG   Streptomyces avermitilis: SAVERM_7289Help
Entry
SAVERM_7289       CDS       T00126                                 

Gene name
mutM2
Definition
(GenBank) putative formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sma  Streptomyces avermitilis
Pathway
sma03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    SAVERM_7289 (mutM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_7289 (mutM2)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SAVERM_7289 (mutM2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SAVERM_7289 (mutM2)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SAVERM_7289 (mutM2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: H2TH Fapy_DNA_glyco zf-FPG_IleRS zf-TFIIB FbpA Ribosomal_S13 zf-RRN7
Motif
Other DBs
NCBI-ProteinID: BAC75000
NITE: SAV7289
UniProt: Q826A4
Position
8693625..8694485
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEALKDFLADHVVGHEVVRVLPVAISVLKTYDPPVTALEGREITAVRRHGKFLD
LEADGLHFVTHLARGGWLHWRDKLPDAPPRPGKGPLALRVALETGEGFDLTEAGTQKRLA
VHVVRDPGDVPGVARLGPDPLADDFDEARFARLLEGERRRIKGALRDQSLIAGVGNAYSD
EILHAAKMSPFKLTSALTAEEIRQLYAALRTTLTEAVERSRGLAAGRLKAEKKTGLRVHG
RTGEPCPVCGDTIREVSFSDSSLQYCPTCQTGGRPLADRRMSRLLK
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactgcccgaggtcgaagcgctcaaggacttcctggccgaccatgtcgtcggc
cacgaggtcgtgcgggtgctgcccgtcgcgatcagtgtcctgaagacgtacgaccccccg
gtcaccgcccttgagggccgggagatcacggcggtgcgccggcacggcaagttcctcgac
ctggaggcggacggcctgcacttcgtgacgcacctggcccgcggcggctggctccattgg
cgggacaagctgcccgacgccccgccccgccccggcaagggcccgctggcgctgcgtgtc
gcgctggagacgggagagggcttcgacctgacggaggccggcacacagaagagactggcc
gtccatgtcgtacgggacccgggtgacgtcccgggcgtggcccggctcggcccggacccg
ctcgccgacgacttcgacgaggcgcgcttcgcgcggcttctggagggcgagcggcgccgg
atcaagggcgcgctgcgcgaccagagcctgatcgcgggcgtggggaacgcgtacagcgac
gagatcctgcacgccgcgaagatgtcaccgttcaagctcacctcggccctgaccgccgag
gagatacgacagctgtacgcggcactgcgtacgacgctcaccgaggcggtcgagcgctcc
cgggggctggccgccgggcggctgaaggcggagaagaagaccgggctgcgggtgcacggc
agaacgggggagccctgtccggtgtgcggggacacgatccgcgaggtctccttcagcgac
tcctcgctccagtactgcccgacctgccagaccggcggcagacccctggcggaccggcgg
atgtcacggctgctcaagtag

DBGET integrated database retrieval system