KEGG   Streptomyces avermitilis: SAVERM_2671Help
Entry
SAVERM_2671       CDS       T00126                                 

Gene name
recG
Definition
(GenBank) putative ATP-dependent DNA helicase
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
sma  Streptomyces avermitilis
Pathway
sma03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sma00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    SAVERM_2671 (recG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sma03400]
    SAVERM_2671 (recG)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SAVERM_2671 (recG)
DNA repair and recombination proteins [BR:sma03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SAVERM_2671 (recG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C tRNA_anti-codon DEAD RecG_wedge LAGLIDADG_3 ResIII Hom_end DUF2388
Motif
Other DBs
NCBI-ProteinID: BAC70382
NITE: SAV2671
UniProt: Q82JT3
Position
complement(3272525..3275752)
Genome map
AA seq 1075 aa AA seqDB search
MDLVPALEEPLKKVLGPATAKVMAEHLGLHTVGDLLHHYPRRYEERGQLTHLADLPMDEH
VTVVAQVADARLHTFASAKAPRGKGQRLEVTITDGSGRLQLVFFGNGVHKPHKDLLPGTR
AMFSGKVSVFNRRLQLAHPAYELLRGADDEAAESVDSWAGALIPIYPATAKLESWKIAKS
VQTVLPSVQEALDPLPDSLRDGRGLISLPEALLKIHRPHTKADIEDARARLKWDEAFVLQ
VALARRRHADAQLPAAARKPKPDGLLTAFDAKLPFTLTEGQQKVSKEIFDDLATEHPMHR
LLQGEVGSGKAQPLDSLVLAPTGFRRMGDLREGDEVVVPNGEIALIDGVFPQGVRDVWRI
VLSDGSSVECDDEHLWIVGTSCGWHRGQTPKVMTTREIRLDTFKANGSSKWYVPAATPVD
LGPDVGLPLDPYLFGLLLGDGSFRHNLRLSTVDDEIRDAAADAVAPDCRLVPVTGSRCDY
TIQLKQRSGGVRNPVIQALRRLDLWGKTSHGKFIPEDFKNTSIKNRLSLLQGLLDTDGTV
HADGMSVSLRSASLRLAEDVAWLVRSLGGRARVLPEKAAFHVSVALPDEYAPFRLSRKAD
RVRPRPKYNTFRRGIRAVEYVGRKPAQCISVGHPSHAYVTDNFTVTHNTMVALRAMLAVV
DSGGQAAMLAPTEVLAQQHHRSITEMMGELAEGGMLGGAEHSTKVVLLTGSMGAAARRQA
LLDLVTGEAGIVIGTHALIEDKVQFHDLGLVVVDEQHRFGVEQRDALRGKGKQPPHLLVM
TATPIPRTVAMTVFGDLETSVLDQLPAGRSPIASHVVPAADKPHFLARAWERVREEVGKG
HQAYVVCARIGDEEDDPKKAKKKSPEDEAEKRPPLAVLEVADQLAKGPLQGLGVEVLHGR
MPPDDKDAVMRRFAAGERDVLVATTVIEVGVNVPNATAMVIMDADRFGVSQLHQLRGRVG
RGSAAGLCLLVTEMPEASPARQRLNAVASTLDGFELSRIDLEQRREGDVLGQAQSGVRSS
LRMLAVIEDEEIIAEAREEAAAVVAADPELGHLPGLRTALEALLDEEREQYLDKG
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atggatctcgtgcccgcgctcgaagaaccactgaagaaggtgctcggacccgccaccgcg
aaggtgatggccgagcacctcggcctgcacaccgtcggagacctgctgcaccactatccg
cgcaggtacgaggagcgcgggcagctcacccacctcgccgacctgcccatggacgagcat
gtgacggtggtcgcccaggtcgccgacgcccgcctgcacaccttcgcctcggccaaggca
ccccgcggcaagggccagcgcctcgaagtgaccatcaccgacggcagcggccgcctccag
ctggtcttcttcggcaacggcgtgcacaagccgcacaaggacctcctgccgggcacacgc
gcgatgttctcgggcaaggtctccgtcttcaaccgccgcctccagctggcccatccggcg
tacgagctgctgcgcggcgccgacgacgaagccgcggagagcgtggacagctgggccggc
gccctcatcccgatctacccggccaccgccaagctggagtcctggaagatcgccaagtcc
gtgcagacggtgctgccgagcgtccaggaggcgctcgacccgctccccgactccctccgg
gacggccgtggcctgatctccctgcccgaggccctcctgaagatccaccgcccccacacc
aaggcggacatcgaggacgcccgcgcccgcctgaagtgggacgaggccttcgtcctccag
gtggccctggcccgccgccgccacgccgacgcccaactcccggccgcggcaaggaaaccc
aagcccgacggcctcctcaccgccttcgacgccaagctccccttcaccctcaccgaaggc
cagcagaaggtctccaaggagatcttcgacgacctggcgaccgagcacccgatgcaccgg
ctgctccagggagaggtgggttccggtaaggctcagcccctcgactcgctggtgctggcc
cccacgggtttccgacggatgggagacctgcgggagggcgacgaggttgtcgtgcccaac
ggagagatcgcactgatcgacggggtattcccccagggagtgcgtgacgtctggcgcatc
gttctctccgacggaagttccgtggagtgcgacgacgagcacctctggatcgtcggtacg
agttgcgggtggcatcgtggccagacgcccaaggtgatgaccacgcgggagatccgcctc
gacacgttcaaggcgaacgggtcgtcaaagtggtacgtccctgccgcgaccccggtcgac
ctgggaccggatgtcggcctgccactggatccctatcttttcgggctgctgttgggcgac
ggctcattccgacacaatctgcgtttgtccacggtcgatgacgagatccgcgacgctgcg
gcggatgccgtggcacctgactgccggctggttcccgtgacgggttcccgctgcgactac
accatccagctgaagcagcgctccggcggtgtgcggaatcctgtcatccaggctctgcgc
aggctggatctgtggggtaagacgtcccacggcaagttcattcccgaggacttcaagaac
acgtcgatcaagaaccgtctctcgctcctgcaagggcttctggacactgacggcacggtg
cacgcggatgggatgagcgtctctctccgctccgcatcgctcagactcgcagaggatgtc
gcctggctcgtgcgttcgctggggggccgggcgcgagtgctgcccgagaaggccgcgttc
catgtgtcggtggcgctccctgatgagtacgcgcccttcaggctgtcccgtaaggccgat
cgcgtgcgcccgcgcccgaaatacaacacattccgacgaggcattcgagccgtcgagtac
gtaggtcgcaaaccggcccagtgcatcagtgtcggtcacccgagccacgcttatgtcact
gacaacttcacagtgacccacaacaccatggtggcgctccgcgccatgctcgccgtcgtc
gactccggcgggcaggccgccatgctcgcccccaccgaagtgctcgcccagcagcaccac
cgctccatcacggagatgatgggcgagctggccgagggcgggatgctcggcggggccgag
cactccacgaaggtcgtgctgctcaccggctccatgggcgccgccgcgcggcggcaggcc
ctgctcgacctcgtcaccggtgaggccgggatcgtcatcggcacgcacgcgctgatcgag
gacaaggtgcagttccacgacctcggtctggtcgtggtggacgagcagcaccgcttcggg
gtcgagcagcgcgacgccctgcgcggcaagggcaagcagccgccgcacctgctcgtcatg
accgccacgcccattccgcggaccgtcgccatgaccgtcttcggcgatctggagacctcc
gtcctcgaccagctccccgccggccgctcgccgatcgccagccatgtcgtcccggccgcc
gacaagccccacttcctcgcgcgcgcctgggagcgcgtgcgggaggaggtcggcaagggc
catcaggcgtacgtcgtgtgcgcccgcatcggtgacgaggaggacgaccccaagaaggcc
aagaagaagtccccggaggacgaggccgagaagcggcccccgctcgccgtcctggaggtc
gcggaccagctcgccaagggcccgctccagggcctgggggtggaggtcctgcacgggcgg
atgccgcccgacgacaaggacgccgtgatgcgccgcttcgccgccggcgagagggacgtc
ctggtcgcgacgacggtcatcgaggtcggggtgaacgtgcccaacgccaccgcgatggtg
atcatggacgcggaccgtttcggcgtctcccagctgcaccagttgcgcggccgcgtcggc
cgtggctcggccgccgggctctgtctcctggtgaccgagatgcccgaggcgagcccggcc
cgccagcggctgaacgcggtggcgtccaccctcgacggcttcgagctctcccgcatcgac
ctcgaacagcgccgcgagggcgacgtcctcggccaggcccagtccggcgtccgctcctcg
ctgcgcatgctcgccgtcatcgaggacgaggagatcatcgccgaggcccgcgaggaggcg
gccgcagtggtcgccgccgacccggagctggggcacctcccgggcctgcgcaccgccctg
gaggccttgctggacgaggagcgcgagcagtacctggacaagggctga

DBGET integrated database retrieval system