KEGG   Streptomyces avermitilis: SAVERM_2724
Entry
SAVERM_2724       CDS       T00126                                 

Gene name
putA
Definition
(GenBank) putative proline dehydrogenase
  KO
K00318  proline dehydrogenase [EC:1.5.5.2]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_2724 (putA)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     SAVERM_2724 (putA)
SSDB
Motif
Pfam: Pro_dh
Other DBs
NCBI-ProteinID: BAC70435
NITE: SAV2724
UniProt: Q82JN0
Position
complement(3341334..3342260)
AA seq 308 aa
MLGPVILAASRSDRMRRFVSAAPGTKQVVARFIAGESVDQVVPVVQDSAAKGLEVTLDVV
GEDITTREQAYAARDAYLELIGRLKELDLGTQAEMSVKLSMFGQALDGGHELALANVRPV
VEAAAAIGTTVTLDAEDHTTLDSMFAIHEELRKDFPGTGCVIQAYLFRTEADARRLAANG
SRVRIVKGAYKEPAEVAYQQKSEIDKAYVRVLRILMEGEGYPMIGSHDPRLISIAQELAR
RAGRKLDEYEFQMLYGIRGEEHLRLAAEGHRMRVYTAYGTDWYGYFMRRLAEKPANLRFF
ARSMLTRG
NT seq 927 nt   +upstreamnt  +downstreamnt
gtgctgggtcccgtgattctcgccgcgtcgcgcagcgaccgcatgcgccgcttcgtgtcg
gcggcccccggcaccaagcaggtggtcgcccgcttcatcgccggcgagagcgtcgaccaa
gtggtgccggtcgtccaggactccgccgccaaggggctcgaggtcaccctcgacgtcgtc
ggcgaggacatcaccacccgcgagcaggcgtacgccgcccgggacgcgtacctcgaactg
atcggccgcctcaaggagctggacctcggcacccaggccgagatgtccgtcaagctgtcg
atgttcgggcaggcgctggacggcggtcacgagctggccctcgccaatgtccgcccggtc
gtcgaggccgccgccgccatcggcacgaccgtcacgctggacgcggaggaccacaccacc
ctcgactcgatgttcgccatccacgaggagctccgcaaggacttcccggggaccggctgc
gtcatccaggcgtacctcttccgtaccgaggccgacgcccgccgcctcgccgcgaacggc
agccgggtgcgtatcgtgaagggggcgtacaaggagcccgccgaggtcgcgtaccagcag
aagtccgagatcgacaaggcgtacgtccgtgtcctgaggatcctcatggagggtgagggg
tacccgatgatcgggtcccacgacccgcgcctcatctccatcgcccaggagctggcccgc
cgcgccggacgcaagctcgacgagtacgagttccagatgctgtacggcatccgcggcgag
gagcacctgcgcctggcagccgagggccaccggatgcgggtgtacacggcgtacggcacc
gactggtacggctacttcatgcgccgcctcgcggagaagccggccaacctgcgctttttc
gcccgcagcatgctgacccgaggttga

DBGET integrated database retrieval system