KEGG   Streptomyces avermitilis: SAVERM_3215
Entry
SAVERM_3215       CDS       T00126                                 

Gene name
glpX
Definition
(GenBank) putative fructose-1,6-bisphosphatase II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00010  Glycolysis / Gluconeogenesis
sma00030  Pentose phosphate pathway
sma00051  Fructose and mannose metabolism
sma00680  Methane metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
Module
sma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAVERM_3215 (glpX)
   00030 Pentose phosphate pathway
    SAVERM_3215 (glpX)
   00051 Fructose and mannose metabolism
    SAVERM_3215 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    SAVERM_3215 (glpX)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SAVERM_3215 (glpX)
SSDB
Motif
Pfam: FBPase_glpX KH_1
Other DBs
NCBI-ProteinID: BAC70926
NITE: SAV3215
UniProt: Q82IE3
Position
4006107..4007141
AA seq 344 aa
MTENHQLPSELEVPSEAPDRNLALELVRVTEAAAMAAGRWVGRGDKNGADGAAVRAMRTL
VSTVSMNGVVVIGEGEKDEAPMLFNGERVGDGTGPECDIAVDPIDGTTLTAKGMTNAIAV
LAAADRGTMFDPSAVFYMDKLVTGPEAADFVDINAPVSVNIRRVAKAKRSMPEDVTVVIL
DRPRHDGIIKEIRETGARIKLISDGDVAGSILALREGTGIDLLLGIGGTPEGIISACAVK
CLGGTIQGKLWPKDDEERQRAVDAGHDLDRVLFTDDLVSGENVFFVATGITDGELLRGVR
YRAETATTESIVMRSKSGTVRQIRSEHRLSKLRAYSQIDFDRAK
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgaccgagaatcatcagctgccgtccgaactagaggtcccctccgaggcacccgaccgg
aacctcgccctggagcttgtccgggtcaccgaggccgccgcgatggccgcgggccgctgg
gtcggccgcggggacaagaacggcgccgacggcgcggccgtccgcgccatgcggaccctc
gtctccaccgtgtcgatgaacggcgtcgtcgtcatcggcgaaggggagaaggacgaggcc
ccgatgctcttcaacggggagcgcgtcggcgacgggaccggccccgagtgcgacatcgcc
gtcgacccgatcgacggaaccacgctcaccgcgaagggcatgaccaacgcgatcgccgta
ctggcggccgccgaccgcggcaccatgttcgacccgtccgcggtgttctacatggacaag
ctggtcaccgggcccgaggccgccgacttcgtcgacatcaacgccccggtctcggtgaac
atccgccgggtggccaaggccaagcgctccatgcccgaggacgtcaccgtcgtcatcctc
gaccggccgcgccacgacggcatcatcaaggagatccgggagaccggcgcgcgcatcaag
ctgatctccgacggtgatgtcgcgggctccatcctggccctgcgcgagggcaccggcatc
gacctgctgctcggcatcggcggtacgcccgagggcatcatctcggcctgcgccgtgaag
tgcctgggcggcaccatccagggcaagctgtggcccaaggacgacgaggagcggcagcgg
gcggtcgacgcgggccacgacctcgaccgcgtgctgttcaccgacgacctggtctccggc
gagaacgtcttcttcgtcgcgaccggcatcaccgacggcgaactgctgcgcggcgtgcgc
taccgcgccgagacagccacgaccgagtcgatcgtgatgcgctccaagtccggcacggtc
cgtcagatcaggtccgagcaccggttgagcaagctgcgcgcgtacagccagatcgacttc
gaccgcgcgaagtag

DBGET integrated database retrieval system