KEGG   Streptomyces avermitilis: SAVERM_3337
Entry
SAVERM_3337       CDS       T00126                                 

Gene name
accA3
Definition
(GenBank) putative acyl-CoA carboxylase, alpha subunit
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
sma  Streptomyces avermitilis
Pathway
sma00061  Fatty acid biosynthesis
sma00280  Valine, leucine and isoleucine degradation
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
Module
sma_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_3337 (accA3)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_3337 (accA3)
   00640 Propanoate metabolism
    SAVERM_3337 (accA3)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAVERM_3337 (accA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_3337 (accA3)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SAVERM_3337 (accA3)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SAVERM_3337 (accA3)
    6.4.1.3  propionyl-CoA carboxylase
     SAVERM_3337 (accA3)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl ATP-grasp Biotin_lipoyl_2 HlyD_D23 LAL_C2 HlyD_3 Dala_Dala_lig_C RnfC_N
Other DBs
NCBI-ProteinID: BAC71048
NITE: SAV3337
UniProt: Q82I21
Position
4150323..4152095
AA seq 590 aa
MRKVLIANRGEIAVRVARACRDAGIASVAVYAEPDRDALHVRAADEAFALGGDTPATSYL
DIAKVLQAAKDSGADAIHPGYGFLSENAEFAQAVLDAGLVWIGPPPQAIRDLGDKVAARH
IAQRAGAPLVAGTPDPVSGADEVVAFAREHGLPIAIKAAFGGGGRGLKVARTLEEVPELY
DSAVREAVAAFGRGECFVERYLDKPRHVETQCLADTHGNVVVVSTRDCSLQRRHQKLVEE
APAPFLSDAQVEELYSSSKAILKEAGYVGAGTVEFLVGVDGTISFLEVNTRLQVEHPVTE
EVAGIDLVREMFRIADGEELGYGDPELRGHSFEFRINGEDPGRNFLPAPGTVTTFAPPSG
PGVRLDAGVESGSVIGPAWDSLLAKLIVTGATREQALQRAARALAEFNVEGMATAIPFHR
AVVRDPAFAPELTGSAEPFTVHTRWIETEFVNEIKPFTVPTDADAEEEPGRETVVVEVGG
KRLEVSLPSSLGMSLARTGLAAGAKPKRRAAKKSGPVASGDTLASPMQGTIVKVAVEEGQ
EVQEGDLVVVLEAMKMEQPLNAHKSGTIKGLGAEVGASITSGAAICEIKD
NT seq 1773 nt   +upstreamnt  +downstreamnt
gtgcgcaaggtgttgatcgccaaccgtggcgaaatcgctgtccgcgtcgcccgggcctgc
cgtgacgccgggatcgcgagcgtggccgtgtacgcggagccggaccgggacgcgctgcac
gtccgggcggccgacgaggcgttcgccctgggcggtgacaccccggccaccagttacctg
gacatcgccaaggtgctccaggccgccaaggattccggtgcggacgccatccacccgggt
tacggctttctttccgagaacgcggagttcgcccaggcggtcctggacgcgggcctcgtc
tggatcgggccgccgccgcaggccatccgcgacctcggcgacaaggtcgccgcccggcac
atcgcgcagcgcgcgggtgcccccctcgtggcgggcacgcccgacccggtctccggcgcc
gacgaggtcgtcgcgttcgcccgggagcacggtctgccgatcgccatcaaggccgccttc
ggtggcggcgggcgcggtctgaaggtggcccgcaccctcgaagaggtccccgagctgtac
gactcggcggtccgcgaggcggtcgccgcgttcggccgcggcgagtgcttcgtcgagcgg
tacctcgacaagccccggcacgtcgagacgcagtgcctggccgacacccacggcaacgtg
gtcgtcgtgtccacccgcgactgctccctccagcgccgtcaccagaagctggtcgaggag
gccccggcgccgttcctgtcggacgcccaggtcgaggagctgtactcctcctccaaggcg
atcctgaaggaggccggctacgtcggcgcgggcaccgtcgagttcctcgtcggtgtcgac
ggcaccatctccttcctcgaggtcaacacccgcctccaggtcgaacacccggtcaccgag
gaggtcgccggcatcgacctcgtgcgggagatgttccgcatcgccgacggcgaggaactc
ggctacggcgaccccgagctgcgtggtcattccttcgagttccgtatcaacggcgaggac
ccgggccgcaacttcctgcccgcccccggcacggtgacgaccttcgccccgccgtcgggc
ccgggcgtgcgcctggacgccggcgtcgagtccggcagcgtgatcggccccgcctgggac
tccctgctcgccaagctgatcgtcaccggcgccacccgcgaacaggctctccagcgcgcc
gcccgcgccctggccgagttcaacgtcgagggcatggccaccgccatcccgttccaccgc
gcggtggtcagggacccggcgttcgcccccgaactcaccggctccgccgaaccgttcacg
gtccacacccgctggatcgagaccgagttcgtcaacgagatcaagccgttcaccgtcccc
accgacgcggacgccgaggaggagcccggtcgcgagaccgtcgtcgtcgaggtcggcggc
aagcgcctggaagtctccctgccgtcctccctcggcatgtcgctggcccgcaccggcctc
gcggcgggcgccaagcccaagcgccgcgcggccaagaagtccggcccggtggcctccggg
gacaccctcgcctccccgatgcagggcaccatcgtcaaggtcgccgtcgaggagggccag
gaggtccaggaaggcgacctggtcgtcgtactcgaagcgatgaagatggaacagccgctg
aacgcgcacaagtccggcaccatcaagggtctgggcgccgaggtcggcgcgtccatcacc
tccggcgccgccatctgcgagatcaaggactga

KEGG   Streptomyces avermitilis: SAVERM_5277
Entry
SAVERM_5277       CDS       T00126                                 

Gene name
accA1
Definition
(GenBank) putative acetyl/propionyl CoA carboxylase alpha subunit
  KO
K11263  acetyl-CoA/propionyl-CoA carboxylase, biotin carboxylase, biotin carboxyl carrier protein [EC:6.4.1.2 6.4.1.3 6.3.4.14]
Organism
sma  Streptomyces avermitilis
Pathway
sma00061  Fatty acid biosynthesis
sma00280  Valine, leucine and isoleucine degradation
sma00620  Pyruvate metabolism
sma00630  Glyoxylate and dicarboxylate metabolism
sma00640  Propanoate metabolism
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
Module
sma_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAVERM_5277 (accA1)
   00630 Glyoxylate and dicarboxylate metabolism
    SAVERM_5277 (accA1)
   00640 Propanoate metabolism
    SAVERM_5277 (accA1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SAVERM_5277 (accA1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5277 (accA1)
Enzymes [BR:sma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SAVERM_5277 (accA1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SAVERM_5277 (accA1)
    6.4.1.3  propionyl-CoA carboxylase
     SAVERM_5277 (accA1)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Biotin_lipoyl Biotin_lipoyl_2 Dala_Dala_lig_C HlyD_3 ATP-grasp HlyD_D23 ATP-grasp_3 RnfC_N GCV_H NQRA Collagen
Other DBs
NCBI-ProteinID: BAC72989
NITE: SAV5277
UniProt: Q82CR6
Position
complement(6392595..6394697)
AA seq 700 aa
MFDTVLVANRGEIAVRVIRTLRALGVRSVAVFSDADADARHVREADTAVRIGPPPAAESY
LSVERLLEAAARTGAQAVHPGYGFLAENAGFARACADAGLVFIGPPADAISLMGDKIRAK
ETVQAVGVPVVPGSSGSGLTDAQLVDAAREIGMPVLLKPSAGGGGKGMRLVRDERLLADE
IAAARREARASFGDDTLLVERWVDRPRHIEIQVLADGHGNVVHLGERECSLQRRHQKVIE
EAPSVLLDEATRAAMGEAAVQAARSCGYEGAGTVEFIVPGGDPSSYYFMEMNTRLQVEHP
VTELVTGLDLVEWQLRVAAGERLPYGQRDIELTGHAVEARICAEDPARGFLPSGGTVLAL
HEPQSDVVRTDSGLSEGTEVGSLYDPMLSKVIAYGPDRPTALRRLRAALAETVTLGVQTN
AGFLRRLLAHPAVVAGDLDTGLVEREVDGLVAQAVPPEVYAAAALLRHAALGPQASGTSD
SSGSFGTSGSPGTSGASGSSGASAWVDPFSVPDGWRLGGERAWTAHHMRPAGQDPVTVRV
RATADGGVELLLDDGLPPLRGTLPVAVAARGGAASRFAFRLDGVTHTFAALPDGTWLGRD
GDSWHLRDHDPVAASLTGAAHSGVDSLTAPMPGTVTVVKVAVGDEVAAGQSLLVVEAMKM
EHVISAPHAGTVSELDVTPGTTVAMDQVLAVITPAEEETA
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgttcgacaccgttcttgtggccaaccggggtgagatcgccgtccgcgtcatccgtacc
ctgcgcgcgctgggcgtgcgctcggtggccgtcttctccgacgccgacgcggacgcacgg
cacgtccgcgaggccgacacggccgtacggatcggtccgccgccggccgccgagagctat
ctgtccgtggagcggctgctggaggcggccgcccggaccggcgcgcaggcggtgcacccg
gggtacggcttcctcgcggagaacgccggcttcgcgcgtgcgtgcgccgacgcggggctc
gtgttcatcgggccgcccgcggacgcgatctccttgatgggcgacaagatccgcgccaag
gagacggtgcaggcggtcggcgtcccggtggtccccggctcctcgggcagcggcctgacg
gacgcccagctggtcgacgcggcacgggagatcggcatgcccgtactcctgaagcccagc
gcgggcggcggcggcaagggcatgcggctggtgcgcgacgagaggctgctcgccgacgag
atcgccgccgcccgccgcgaggcccgcgcctccttcggcgacgacacgctcctcgtggag
cgttgggtggaccgcccccggcacatcgagatccaggtcctggcggacggccacggcaac
gtggtgcacctgggcgagcgcgagtgctcgctccagcgccgccaccagaaggtcatcgag
gaggcgcccagcgtgctcctcgacgaggcgacccgcgccgcgatgggcgaggcggcggtc
caggcggcccgctcctgcggctacgagggcgcgggcaccgtcgagttcatcgtccccggc
ggggacccctcctcgtactacttcatggagatgaacacccgccttcaggtcgagcacccg
gtcaccgagctggtcaccggcctcgacctggtggagtggcagctccgggtggccgcgggc
gagcgccttccgtacgggcagcgggacatcgaactcaccgggcacgcggtcgaggcccgc
atctgcgccgaggaccccgcgcgcggcttccttccctccggggggacggtgctcgcgctg
cacgagccacagagcgacgtggtgcgcaccgactcgggcctctccgagggcaccgaggtc
ggcagcctgtacgacccgatgctctccaaggtcatcgcgtacggccccgaccgcccgacc
gcgctgcgcaggctccgggcggcgctcgcggagacggtcacactcggcgtgcagaccaac
gccgggttcctgcggcggctgctggcccacccggcggtcgtggcgggggacttggacacg
ggcctggtggagcgggaggtggacgggctcgtcgcgcaggcggtcccgccggaggtgtac
gcggcggcggcgctgctgcgccacgccgccctcggcccccaggcttcagggacctcggat
tcctccgggtccttcgggacatccgggtcccccgggacctcaggggcctccggctcgtcc
ggggcctccgcctgggtcgatccgttctccgtgcccgacggctggcgtctgggcggcgag
cgtgcctggacggctcaccacatgcggccggcggggcaggatcccgtgaccgtccgcgtg
cgcgccacggcggacggcggcgtcgagctgctactcgacgacggactgccgcccctgcgg
ggcacgctccccgtagcggtggccgcccgcgggggcgccgcgtcccggttcgccttccgg
ctcgacggcgtcacccacaccttcgccgccctgccggacggcacctggctgggccgcgac
ggcgactcctggcacctgcgcgaccacgacccggtcgcggcgtccctcaccggcgccgcc
cactccggcgtcgactccctcaccgcccccatgcccggcacggtgaccgtcgtgaaggtc
gccgtcggggacgaagtggccgccgggcagagcctgctggtggtcgaggcgatgaagatg
gagcacgtcatctccgccccgcacgccggcaccgtcagcgagctggacgtcacaccgggc
acgaccgtcgccatggatcaggtgctggcggtcatcacccccgcagaggaggagacggca
tga

DBGET integrated database retrieval system