KEGG   Streptomyces avermitilis: SAVERM_3706
Entry
SAVERM_3706       CDS       T00126                                 

Gene name
aco
Definition
(GenBank) putative acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00410  beta-Alanine metabolism
sma00592  alpha-Linolenic acid metabolism
sma00640  Propanoate metabolism
sma01040  Biosynthesis of unsaturated fatty acids
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01200  Carbon metabolism
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_3706 (aco)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_3706 (aco)
   00592 alpha-Linolenic acid metabolism
    SAVERM_3706 (aco)
   01040 Biosynthesis of unsaturated fatty acids
    SAVERM_3706 (aco)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_3706 (aco)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     SAVERM_3706 (aco)
SSDB
Motif
Pfam: ACOX Acyl-CoA_dh_2 Acyl-CoA_dh_1 Collagen Acyl-CoA_dh_M
Other DBs
NCBI-ProteinID: BAC71418
NITE: SAV3706
UniProt: Q82H40
Position
4585720..4587741
AA seq 673 aa
MIATTFEAGPVATGHPVADHLAHLLFEGTGRERTHGTWRRLISGREFSYRPGLAPAERTA
LSYDRLRLLNDTVDDPVRLAADPHRLAALHEWIGPVDGGLTTLASIHYNLFLGSLVDHDD
NGRDLSAFTTLQQVGTFLCTELEHGNDVAAMETVAVFDRASGGFHLHTPTPGAQKFMPNT
STTGGPKSAVVAARLVVDGRDEGVFLFLTPLGDRSGLLPGVRVRPLPERTGTPVDHALTA
FDHKWLPREALLEAAHGRLAPDGTLTSTLGNRRKRLLRSINRVTMGKLCMSAGTLGMARA
ALTIAVRYAHSRLVTGPRAGERIPVAAHRSHHGRLLDALATAYAMTFLHRTVVDRFAART
EEDREEVERLTAVAKGWITWQARAITTECRERCGAQGLFPANGISDLASNIEGGITAEGD
NLVIWVKAAAEMVFGHDTTARTRAGAPAAPNSSAALSAPNRPAAPATPSAPGAPATPGAP
GAPGAPGAPGAPGAPGAPGAPGATLADPAFLRGLLAEAEAIWQARARADLRDGPAGDPVG
RWNGTSTAALEMVSAHARLQAADALIAAAERATDPTARFLLRSLCRLFLLRRLRDHTGDL
LAEGHLTADHVRALPRALDSVYDDLAPHLMTLVDAFDFPAEMLSAIPIASGGTIVRTLEQ
SAEEWPLVSPASP
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgatcgctacgacgttcgaggccggcccggtcgccacgggacacccggtcgccgaccac
ctggcacacctgctcttcgaggggaccggccgcgagcggacgcacggcacctggcgcagg
ctgatctccggccgggagttctcgtaccggcccggcctggcccccgccgagcgcaccgca
ctctcgtacgaccggctgcggctgctcaacgacaccgtcgacgacccggtgcggctcgcc
gccgacccgcaccggctggccgcgctgcacgagtggatcgggccggtcgacgggggcctg
accacgttggcgagcatccactacaacctgttcctcggcagcctcgtggaccacgacgac
aacgggcgcgacctgtccgccttcaccaccctccagcaggtcggaacgtttctctgcacc
gaactggagcacggcaacgacgtggcggccatggagaccgtggcggtcttcgaccgcgcg
agcggcggcttccatctgcacacaccgacgccgggcgcgcagaagttcatgcccaacacg
agcacgacgggcggccccaagagcgcggtggtcgccgcccggctcgtcgtcgacggccgg
gacgagggcgtcttcctcttcctgaccccgctcggcgaccggtccggcctcctgccgggc
gtacgggtccgcccgctgccggagcgcacgggcaccccggtggaccacgccctcaccgcc
ttcgaccacaagtggctgccgcgcgaggcgcttctggaggccgcccacggacgactcgcc
cccgacggcaccctgaccagcaccctcggcaacaggcgcaaacgcctcctgcgctccatc
aaccgcgtcaccatgggaaagctgtgcatgagcgccggcaccctgggcatggcgcgcgcc
gcgctgaccatcgcggtccgctacgcccacagccgcctcgtgacgggcccgcgggccggg
gagcggataccggtcgccgcccaccgcagccaccatggccggctgctcgacgcgctggcg
acggcgtacgcgatgaccttcctgcaccgcacggtggtggaccgtttcgcggcacgcacc
gaggaggaccgggaggaggtcgagcggctgacggcggtcgccaaggggtggatcacctgg
caggcgcgggcgatcaccaccgagtgccgcgaacgctgcggcgcccagggcctgttcccg
gccaacggcatctccgacctggcgtcgaacatcgagggcggcatcaccgccgagggcgac
aacctggtgatctgggtgaaggcggcggcggagatggtcttcggccacgacacgacggcc
cgcacccgggccggggcccccgccgcacccaacagctccgccgcactctccgcgcccaac
cgccccgccgcgcccgccactccctccgcacccggcgcacccgccactcccggcgctccc
ggcgctcccggcgctcccggcgctcccggcgctcccggcgctcccggcgctcccggcgct
cccggcgccacgctcgccgacccggccttcctgcgcggtctgctcgccgaggcggaggcg
atctggcaggcacgggcccgcgccgacctgcgtgacggcccggcgggcgatccggtcggc
cggtggaacggcacgtcgaccgccgccctcgaaatggtctccgcgcacgcccgtctccag
gccgccgacgcgctcatcgccgcggccgagcgggcgacggaccccacggcgcgcttcctg
ctgcgctccctgtgccggctgttcctgctccgccggctccgcgaccacaccggtgacctg
ctcgccgagggccatctgacggcggaccacgtacgggcgctgccgagggccctcgacagc
gtgtacgacgacctggccccgcacctgatgacgctggtcgacgcgttcgacttcccggcc
gagatgctctccgcgatccccatcgccagcggcggcacgatcgtccgcacgctggagcag
tcggcggaggaatggccactggtctcgccggcctccccctga

DBGET integrated database retrieval system