KEGG   Streptomyces avermitilis: SAVERM_5285
Entry
SAVERM_5285       CDS       T00126                                 

Gene name
speB
Definition
(GenBank) putative agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
sma  Streptomyces avermitilis
Pathway
sma00330  Arginine and proline metabolism
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    SAVERM_5285 (speB)
Enzymes [BR:sma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SAVERM_5285 (speB)
SSDB
Motif
Pfam: Arginase DUF3373 UPF0489
Other DBs
NCBI-ProteinID: BAC72997
NITE: SAV5285
UniProt: Q82CQ8
Position
6403444..6404412
AA seq 322 aa
MSSNETPRGPVDSSRVPRYAGPATFARLPRLDEVGTADVAVVGVPFDSGVSYRPGARFGG
NAIREASRLLRPYNPAQDASPFALAQVADAGDIAANPFNINEAVETVEAAADELLGTGAR
LMTLGGDHTIALPLLRSVAKKHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAVEEGIL
DTEALSHVGTRGPLYGKQDLTDDEKMGFGIVTSADIYRRGADEVADQLRQRIGDRPLYIS
IDIDCLDPAHAPGTGTPEAGGMTSRELLEILRGLASCNLVSADVVEVAPAYDHAEITAVA
ASHTAYELTTIMSRQIAEARNK
NT seq 969 nt   +upstreamnt  +downstreamnt
atgagcagcaacgagacgccccgcggccccgtcgactcgtcccgcgtcccgcggtacgcc
ggccccgcgaccttcgcccggctgccgcgcctcgacgaggtcggcaccgccgatgtcgcc
gtggtcggtgtgccgttcgactccggcgtctcgtaccggccgggcgcccgcttcggcggc
aacgcgatccgcgaggcgtcccggctcctgcgcccgtacaacccggcgcaggacgcctcg
cccttcgcgctcgcccaggtcgcggacgcgggtgacatcgcggcgaacccgttcaacatc
aacgaggccgtggagacggtcgaggccgcggccgacgagctgctcggcaccggcgcccgg
ctgatgaccctcggcggcgaccacaccatcgcgctgccgctgctgcgctcggtcgccaag
aagcacggcccggtggcgctgctccacttcgacgcgcacctcgacacctgggacacctac
ttcggcgccgagtacacgcacggcaccccgttccgccgggccgtcgaggagggcatcctc
gacaccgaggcgctctcccacgtcggcacccgcggcccgctgtacggcaagcaggacctc
accgacgacgagaagatgggcttcggcatcgtcacctcggcggacatctaccgccgcggc
gccgacgaggtcgccgaccagctgcgccagcgcatcggtgaccgtccgctgtacatctcc
atcgacatcgactgcctcgacccggcgcacgcgcccggcacggggacgccggaggcgggc
ggcatgacgtcgcgcgaactcctggagatcctgcggggcctcgcgtcctgcaacctggtc
tcggccgacgtcgtcgaggtcgccccggcgtacgaccacgccgagatcacggccgtcgcc
gcgtcccacacggcgtacgagctcaccacgatcatgtcccgtcagattgcggaggcccgg
aacaagtga

DBGET integrated database retrieval system