KEGG   Streptomyces avermitilis: SAVERM_5723
Entry
SAVERM_5723       CDS       T00126                                 

Gene name
fadD13
Definition
(GenBank) putative acyl-CoA synthetase, long-chain fatty-acid:CoA ligase
  KO
K18662  malonyl-CoA/methylmalonyl-CoA synthetase [EC:6.2.1.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00280  Valine, leucine and isoleucine degradation
sma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_5723 (fadD13)
Enzymes [BR:sma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     SAVERM_5723 (fadD13)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C TetR_C_20
Other DBs
NCBI-ProteinID: BAC73435
NITE: SAV5723
UniProt: Q82BI2
Position
complement(6923259..6924728)
AA seq 489 aa
MSSLFPALSGGAAERRPALRFGDRALTYAELAAAAGCLAARISGSGRVAVWATPTLETAV
GVVAALLAGVPAVPLNPRSGESELGHILADSAPSLILAAAGDELPSAVRGLERVDVEVNA
PAAGAPAPATGSVTDDAPALIVYTSGTTGPPKGAVLPRHAIATTLDALADAWQWTADDVL
VHALPLFHVHGLILGILGPLRRGGSVRHLGRFGTDGVARELNDGATMVFGVPTMYHRIAE
ALPDDPGLAKALGRARLLVSGSAALPVHDHERIAAATGRRVIERYGMTETLMNTSVRADG
EPRAGTVGVPLPGVQLRLVEEDGSPVPSCDGESVGEIQVRGPNLFTEYLNRPDATAAAFT
EDGWFRTGDMAVRDADGYVRIVGRKATDLIKSGGYKIGAGEIENALLEHPGVREVAVTGE
PDDDLGERIVAWVVPADPGTPPDADELAGHVARRLAPHKRPRTVRFLDSLPRNDMGKIMK
RALPQGSGH
NT seq 1470 nt   +upstreamnt  +downstreamnt
gtgtcctccctcttcccggccctgtcaggcggtgcggccgagcggcggcccgccctgcgt
ttcggcgaccgcgcactgacctacgcggaactcgccgcggccgcgggttgtctggcggcc
cggatcagcggctcggggcgggtcgccgtctgggcgacccccactctggagaccgccgtc
ggcgtcgtggccgcgctgctcgccggggtgcccgccgtaccgctcaaccccaggtcggga
gagagcgagctcgggcacatcctcgccgacagcgcgccgtccctgatcctggccgcggcc
ggggacgaactcccgtccgccgtacggggactggagcgcgtcgacgtcgaggtgaacgca
cccgccgccggcgcccccgccccggccaccgggagcgtcacggacgacgcccccgcgctc
atcgtctacacctccggcaccaccggcccgcccaagggtgccgtcctcccccgccacgcc
atcgccacgaccctggacgcgctggccgacgcctggcagtggaccgccgacgacgtcctc
gtgcatgcgctgcccctgttccatgtgcacgggctgatcctgggcatcctcggtccgctg
cgccgcggcggctccgtacggcacctcgggcggttcggcacggacggtgtggcgcgcgag
ctgaacgacggcgcgaccatggtcttcggcgtccccaccatgtaccaccggatcgccgaa
gccctccccgacgaccccgggctggccaaggcgctgggccgggcccggctgctggtctcc
ggttccgccgcgttgcccgtccacgaccacgagcggatcgccgccgcgaccgggcgccgg
gtcatcgagcggtacggcatgacagagaccctcatgaacaccagcgtccgcgcggacgga
gaaccgcgcgccggtaccgtcggcgtgccgctgccgggcgtccagctgcggctggtcgag
gaggacggctcgcccgtcccgtcctgcgacggcgagagcgtcggcgagatccaggtccgc
ggcccgaacctcttcaccgagtacctcaaccggcccgacgccaccgccgccgcgttcacc
gaggacggctggttccgcaccggcgacatggcggtgcgcgacgccgacgggtacgtacgc
atcgtgggccgcaaggccaccgacctcatcaagagcggtggctacaagatcggcgccggc
gagatcgagaacgcgctcctggagcacccaggggtgcgcgaggtggccgtcaccggggag
cccgacgacgatctgggcgagcggatcgtcgcctgggtggtgcccgcggaccccggcacc
ccgccggacgccgacgagctggccggccatgtggcccgccgcctcgccccgcacaagcgg
ccccggaccgtgcgcttcctcgactcgctgccccgcaacgacatggggaagatcatgaag
cgggcgctgccgcagggaagcgggcactga

DBGET integrated database retrieval system