KEGG   Streptomyces avermitilis: SAVERM_717
Entry
SAVERM_717        CDS       T00126                                 

Gene name
echA3
Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sma  Streptomyces avermitilis
Pathway
sma00071  Fatty acid degradation
sma00280  Valine, leucine and isoleucine degradation
sma00281  Geraniol degradation
sma00310  Lysine degradation
sma00360  Phenylalanine metabolism
sma00362  Benzoate degradation
sma00380  Tryptophan metabolism
sma00410  beta-Alanine metabolism
sma00627  Aminobenzoate degradation
sma00640  Propanoate metabolism
sma00650  Butanoate metabolism
sma00903  Limonene and pinene degradation
sma00930  Caprolactam degradation
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
sma01120  Microbial metabolism in diverse environments
sma01212  Fatty acid metabolism
Module
sma_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SAVERM_717 (echA3)
   00650 Butanoate metabolism
    SAVERM_717 (echA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAVERM_717 (echA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAVERM_717 (echA3)
   00310 Lysine degradation
    SAVERM_717 (echA3)
   00360 Phenylalanine metabolism
    SAVERM_717 (echA3)
   00380 Tryptophan metabolism
    SAVERM_717 (echA3)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SAVERM_717 (echA3)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SAVERM_717 (echA3)
   00281 Geraniol degradation
    SAVERM_717 (echA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAVERM_717 (echA3)
   00627 Aminobenzoate degradation
    SAVERM_717 (echA3)
   00930 Caprolactam degradation
    SAVERM_717 (echA3)
Enzymes [BR:sma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SAVERM_717 (echA3)
SSDB
Motif
Pfam: ECH_1 ECH_2
Other DBs
NCBI-ProteinID: BAC68427
NITE: SAV0717
UniProt: Q82Q04
Position
complement(869743..870525)
AA seq 260 aa
MSTAPEAADLVLHERHGGVLTITINRPAQKNAVDHEAAVQLAAAVDLLDADPELSVGVLT
GAGGVFSAGMDLKAFAKGELPLLPSRGLGGLTRASVRKPLVAAVEGWALGGGFELVLACD
LIVAAEDARFGFPEVMRGLVAAEGGLVRLPRRLPYHVAARVLLTGEPLTAVEAKEYGLVN
ELTPPGAALDAARELAGRVARNAPLALAAVKEVLRETQGLKESDAFRRQDELTSGLAASE
DAREGAQAFAEKRAPVWHGR
NT seq 783 nt   +upstreamnt  +downstreamnt
atgagcacggcgcccgaagctgccgacttggtgctccacgagcgtcacggcggcgtactg
accatcaccatcaaccgccccgcgcagaagaacgccgtcgaccacgaggccgcggtacag
ctcgcggcggccgtggatctgctcgacgcggacccggagctgtcggtcggcgtcctcacg
ggcgcgggcggggtgttcagcgcgggcatggacctgaaggcgttcgccaagggcgagctg
cccttgctgcccagccggggcctgggcgggctcacccgcgcgtcggtgcgaaagccgctg
gtcgccgcggtcgagggctgggcgctcggcggtggcttcgagctggtcctcgcctgcgac
ctgatcgtcgccgcggaggacgcccgcttcgggtttcccgaggtcatgcgtggtctcgtg
gcggcggagggcggactggtcaggctgccgcgccgacttccgtaccacgtcgccgcgcgc
gtactgctgacgggcgagccgctgaccgccgtcgaagccaaggagtacgggctcgtcaat
gagctgaccccgcccggcgccgcgctggacgcggcccgggagctcgcgggccgcgtcgcg
cggaacgcaccgcttgcactggcggccgtcaaggaggtcctgcgcgagacacagggcctg
aaggagagcgacgcgttcagacgccaggacgagctcacgagcggactggccgccagcgag
gacgcgcgggaaggcgcacaggcgttcgccgagaaacgcgccccggtctggcacggccgc
tga

DBGET integrated database retrieval system