KEGG   Sinorhizobium meliloti 1021: SM_b20132
Entry
SM_b20132         CDS       T00058                                 

Definition
(RefSeq) dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme00230  Purine metabolism
sme01100  Metabolic pathways
sme01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sme00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SM_b20132
Enzymes [BR:sme01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     SM_b20132
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-GeneID: 1236463
NCBI-ProteinID: NP_436672
RhizoBase: SM_b20132
UniProt: Q92X30
Position
pSymB:143977..146295
AA seq 772 aa
MNTYERIDRDLSDRDFTVVGKSVKRSDTLEKVTGTARYAGDVALPGMLHAKMKRSNIAHA
RIRSIDTSKALALKGVKAVLTHEDVPRVLHAGSPHPRSASVTKDQYILDDRVRYWGEGVA
AVAAVSEEIAERAVALIEVEYEPLPGLFTIEAASVPGAPPIHENGLDRNQVLPPVFVTRG
DVDRGFAEADLILEREYDLGRPTPAYMEPNVCVSQWDGNGKLTMWTSTQSAFMVRGTLAE
VLGVPLNKVRVIVDHMGGGFGAKQDLFQNEFLCALLARQTGRPVKMEFSRKETFLGGRSR
HPGKIWLKQGFTKDGRIVAREARVTFNSGAYGSHGPGVTNVGTAALTSLYRCENVRLEGR
CIYTNSPIAGAFRGYGVVQTYYALDLMMDEAAEKLGFDPAEFKLMNAVREGDIAPSGHPI
VGHGLGDCIRRVMEETNWHELRRREKPETVKRRGIGIGCEMHGSSAYPGIKEQGNAIVKM
NEDGTVTLITGTAGLGTGAHTALSQIVAEELGVPFEAVSVVQGDTDIVPWDIGAFASHTT
YLGGRAAQLAAADVRRQVLEHAAPMLKAEPENLAIRDGFVVVTNGSNRSIRLSEAVGPQR
GMPAVQLVGVGTYMPTKSYSFAAHFAEVEVDTETGEVAVLQVVPVHEIGRVIHPIAAAGQ
IEGGIQQGIGHTLSEDYVIDLTDGRSLNPSFVDYKMPLSMDMPSIRTIILETAPDPGGPY
GAKGVGEDPIIAIGPAIANAIYDAIGVRFHHYPITPEQVLNALKSKANETRQ
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaacacatatgaaaggatcgacagagacctgtccgaccgggacttcaccgtcgtgggc
aagagcgtcaagcgttccgatactctggagaaggtcacggggacggccagatatgcaggc
gacgtcgccttgcccggcatgctccacgccaagatgaagcgcagcaacatcgctcatgcg
cgcatcaggagcatcgacacgagcaaggcgctggcgctcaagggcgtcaaggcggtgctg
acgcacgaggacgtgccgcgcgttttgcatgcgggctcaccgcatccgcgctcggcatcc
gttaccaaggatcagtacatcctggatgacagggtgcgatattggggcgagggcgtcgcc
gcagtcgctgccgtcagcgaggaaatcgctgagcgcgcggtcgcgctcatcgaggtcgag
tacgagcccttgcccggcctcttcaccatcgaagccgcatcggtgcccggcgctccgccg
atccatgagaatggtctcgaccggaaccaggtgttgccgccggtcttcgtcacccgcggc
gacgtcgataggggtttcgccgaagcggatctgatcctcgagcgcgaatacgatctcggc
cgcccgacaccggcctatatggagcccaatgtctgtgtcagccagtgggacggcaacggc
aagctcaccatgtggacctcgacccagagcgcattcatggtccgcggcacgcttgccgaa
gtgctcggcgtgccgctgaacaaggtacgcgttatcgtcgatcacatgggcggcggcttc
ggcgcgaagcaggatctgtttcagaacgagttcctctgcgccctgctcgcgcgacagacg
gggcgtccggtcaagatggagttcagccgcaaggaaacgttcctcggcggccgctcgcga
caccccggcaagatatggctgaagcagggcttcaccaaagacggccggatcgtcgcacgc
gaagccagggtcaccttcaactccggcgcctacggctcgcacggtccaggcgtcaccaat
gtcggcaccgcagcgctgacctcgctctaccgttgcgagaatgtccggctggaaggccgc
tgcatctataccaattcgccgattgccggcgcctttcgcggctatggtgtggttcagacc
tactatgcgctcgacctcatgatggacgaggcggccgagaagctcggcttcgacccggcc
gagttcaagttgatgaacgcggtgcgcgagggcgacatcgcaccctccgggcacccgatc
gtcggacacggcctgggggattgcatccgccgcgtcatggaggagacgaactggcacgaa
ttgcgcaggcgggagaagccggaaaccgtcaagcgccgcgggatcgggatcggctgcgaa
atgcacggatccagtgcctatccgggcatcaaggaacagggcaacgcaatcgtgaagatg
aacgaggacggaacggtgacgctgatcaccggcaccgccggcctcggcaccggcgcgcat
acggcgctttcgcagatcgtcgccgaggaactcggcgtgcccttcgaagccgtctcggtc
gttcaaggggacaccgatatcgtcccctgggatatcggtgccttcgccagccacacgacc
tatctcggcggacgggcggctcagctcgcggccgccgacgtgcgcagacaagtgctcgaa
cacgccgcgcccatgctcaaggccgagcccgagaatctcgcgattcgggacggtttcgtg
gtcgtcaccaacggctccaaccgcagcatccggctttccgaggccgtcgggccgcaacgg
gggatgccggcggtgcaactggtcggcgtaggcacctacatgccgacgaagtcctactcc
ttcgccgcccatttcgccgaagtcgaggtggacaccgagaccggcgaggtcgccgttctc
caggtcgttccggtacatgagatcggcagggtcatccatccgatcgccgcggccggacag
atcgagggcggcattcagcagggcatcggccacaccctcagcgaggattacgtcatcgac
cttaccgacggacgttccctcaatccgagcttcgtcgattacaagatgcccctgtcgatg
gacatgccgtccatccgcaccatcatcctcgagacggcgccggatcccggaggtccctac
ggtgccaagggcgtcggcgaggatccgatcatcgcgatcgggcccgccatcgccaacgcc
atctacgacgccatcggcgtccgcttccaccactacccgataacgcccgagcaggtgttg
aacgctctcaagtccaaagccaacgaaacgaggcagtga

DBGET integrated database retrieval system