KEGG   Sinorhizobium meliloti 1021: SMa0929
Entry
SMa0929           CDS       T00058                                 
Symbol
traG
Name
(GenBank) TraG conjugal transfer protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMa0929 (traG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sme02044]
    SMa0929 (traG)
Enzymes [BR:sme01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     SMa0929 (traG)
Secretion system [BR:sme02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   SMa0929 (traG)
SSDB
Motif
Pfam: T4SS-DNA_transf TraG-D_C TrwB_AAD_bind
Other DBs
NCBI-ProteinID: AAK65160
RhizoBase: SMa0929
UniProt: Q92ZI3
Position
pSymA:complement(513088..515007)
AA seq 639 aa
MALKAKPHPSLLVILFPVAVTAAAVYVVGWRWPGLAAGMSGKTAYWFLRAAPVPALLFGP
LAGLLAVWALPLHRRRPVAMASLACFLTVAGFYALREFGRLSPSVESGALSWDRALSYLD
MVAVVGAVVGFMAVAVSARISTVVPEPVKRAKRGTFGDADWLPMAAAGKLFPPDGEIVIG
ERYRVDKDIVHELPFEPNDPATWGQGGKAPLLTYRQDFDSTHMLFFAGSGGYKTTSNVVP
TALRYTGPLICLDPSTEVAPMVVEHRTRVLGREVMVLDPTNPIMGFNVLDGIEHSRQKEE
DIVGIAHMLLSESVRFESSTGSYFQNQAHNLLTGLLAHVMLSPEYAGRRTLRSLRQIVSE
PEPSVLAMLRDIQERSASTFIRETLGVFTNMTEQTFSGVYSTASKDTQWLSLDSYAALVC
GNAFKSSDIVSGKKDVFLNIPASILRSYPGIGRVIIGSLINAMIQADGSFKRRALFMLDE
VDLLGYMRLLEEARDRGRKYGISMMLLYQSLGQLERHFGRDGAVSWIDGCAFASYAAVKA
LDTARNISAQCGEMTVEVKGSSRNIGWDTKNSASRKSENVNYQRRPLIMPHEITQSMRKD
EQIIIVQGHSPIRCGRAIYFRRKDMNEAAKANRFVKAIP
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggcactgaaggcaaaaccgcatccgagcctgttggtcattctctttcccgtcgccgtc
accgccgctgccgtctatgtcgtcggctggcgctggccggggctcgccgccggcatgtcg
gggaagacggcatattggttcctgcgggcggcgcccgtgccagcgctactgttcgggccg
ctcgccggcctgttggccgtttgggccttgccattgcaccggcgaaggccagtcgcaatg
gcgagcctcgcctgttttctgacggtcgcgggcttctacgcgctccgtgaattcggccgg
ctgtccccctccgtggaaagcggtgcgctatcatgggaccgggcgctgtcctacctcgac
atggtcgctgtcgtcggcgcggtcgttggctttatggccgtcgctgtctccgcgcgcatc
tccaccgtcgtgcccgaaccggtaaagcgcgctaagcgcggaaccttcggtgacgcggac
tggctgccgatggcggcggcgggaaagctgtttccgccggacggcgagatcgtcatcggg
gagcgctaccgcgtcgacaaggacattgtccacgaactgcccttcgagccaaacgatccg
gcgacttggggccaaggcggcaaggcccctttgctgacctaccgccaggacttcgattcc
acccatatgctgttctttgcgggctcgggtggatacaagacgaccagcaacgtcgtgccg
acggcgctgcgttataccgggccgctcatctgcctcgatccgtcgaccgaggtcgcgccc
atggtggtcgagcaccgaacccgcgtgctcggccgcgaggtgatggttcttgatccgacg
aacccgatcatgggcttcaacgtgctcgacgggatcgagcactcacggcaaaaggaagag
gacatcgtcggcattgcccacatgctgctgtcagaaagcgtgcgcttcgaaagctcgacc
ggctcctacttccagaaccaggcgcacaatctcctgaccggtctgctcgcccatgtgatg
ctgtcgcccgaatatgccggacggcggacgttacgcagtctccggcagatcgtatccgag
ccagagccgtcggtgctggcgatgctgcgtgacattcaggagcgttccgcgtccactttc
atccgcgaaacgctcggcgtcttcaccaatatgaccgagcagactttttcgggcgtctac
tcgacggcgtcgaaggatacgcagtggctgtcgctcgacagctacgccgcgctcgtttgc
ggcaatgcgttcaagtcgagcgatatcgtctcgggcaagaaggacgtgttcctgaacatc
cccgcgtcgatcctgcgctcctatccgggcatcggccgcgtcatcatcggctcgctgatc
aatgccatgatccaggccgatggctcattcaagcgccgggcgttgttcatgttggatgag
gtcgatctcctcggctacatgcgcctcctcgaggaggcacgcgaccgcggccgcaagtac
ggcatcagcatgatgctgctgtaccaatccctagggcagctggagcggcatttcgggagg
gacggtgcggtgtcgtggatcgacggatgcgccttcgcctcctatgccgcggttaaggcg
ctggacacggcgcgcaacatttcggcgcaatgcggagaaatgacggttgaggtaaaagga
agctcccgcaatatcggctgggacacgaagaacagcgcatcgcgcaaatcggaaaacgtc
aattaccagcgccggccgctgatcatgccgcacgaaatcacccagtcgatgcgaaaggac
gaacagatcatcatcgtccagggccacagcccgattcgctgcgggcgcgcgatctacttc
cggcggaaggacatgaacgaggcggcgaaggccaatcgcttcgtcaaggcgattccttga

DBGET integrated database retrieval system