KEGG   Sinorhizobium meliloti 1021: SMa1315
Entry
SMa1315           CDS       T00058                                 
Symbol
virB4
Name
(GenBank) VirB4 type IV secretion protein
  KO
K03199  type IV secretion system protein VirB4 [EC:7.4.2.8]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SMa1315 (virB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sme02044]
    SMa1315 (virB4)
Enzymes [BR:sme01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     SMa1315 (virB4)
Secretion system [BR:sme02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   SMa1315 (virB4)
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_22 ATPase_2 FtsK_SpoIIIE AAA_16 T2SSE ABC_tran cobW TrwB_AAD_bind AAA_24 RsgA_GTPase
Other DBs
NCBI-ProteinID: AAK65374
RhizoBase: SMa1315
UniProt: Q92YZ6
Position
pSymA:complement(717133..719511)
AA seq 792 aa
MPSLTTLRSRELGPETFIPYVRHVDESTIALDSRALMVMIALEGVSFETADILDLNALHR
DLNTLYRNIADERLALWTHLIRRRDNSYPEGTFATPFSAALNDKYRERMVGEDLFRNDLY
LSILWSPARDPADKAAKLLSRLRRARRVGTELDEGALKHLRDKVIDVTAALRRFEPRVLT
LYEHDGLMFSEPSEVLHQLVGGRREPIPLTEGHIASAIYSDRVIVGRETIEIRHEADSRY
AGMLSFKEYPARTRTGMLDAVLTSPFELILAQSFSFVSKADARMIMGRKQNQMVSSGDKA
ASQIEELDGAMDDLESNRFVFGEHHLTLSVFAPSVKELTDNLAKARASMTSGGAVVARED
LGLEAAWWAQLPGNFRYRARSGAITSRNFAALSPFHSYPLGQKDGNEWGPAVALLKTASG
SPYYFNFHYGDLGNTFVCGPSGAGKTVLLNFMLSQLEKHDPHVVFFDKDRGADLYVRAAG
GTYLPLKNGIPTGCTPLKALELTPENKVFLTRWVGKLVGSATRELSVTELRDISSAIDGL
ADLPVERRTIGALRTFLDNTNPEGIAARLRRWERGGPLGWVFDNVIEDIGFGEFGGGKLV
GYDMTDFLDNEEIRAPLMAYLFHRVEQLIDGRRIIIVIDEFWKALQDEGFRDLAQNKLKT
IRKQNGLMLFATQSPRDAIVSPIAHTIIEQCPTQIFLPNSRGNHGDYVDGFKLTEREFEL
VARELSIESRRFVLKQGHNSVVAELDLKGLDDELAILSGRTANVELADAIRAEVGSNAKD
WLPVFQQRRSAT
NT seq 2379 nt   +upstreamnt  +downstreamnt
ttgcctagcctgaccacactcagatctcgcgaactcggtccggagaccttcatcccctat
gtccgccatgtcgacgagtcgacaatcgcgctcgattcccgggcgctgatggtgatgatc
gcgctcgaaggcgtctccttcgagaccgccgatattctcgacctgaatgccctccatcgc
gacctcaacaccctctaccgcaacatcgccgacgagcggcttgccttgtggacgcatctc
atccgccgtcgcgacaacagctatccggaaggcacgttcgccacaccgttctcggcggcg
ctcaacgataagtaccgcgaaagaatggtgggcgaggacctgtttcgcaacgacctctat
ctgtcgattctctggtcaccagctcgcgatccggcagacaaggcggcaaaactgctgtcg
cgcctgcgtcgggcccgccgggtcgggaccgaactcgatgagggcgccctcaagcatctc
cgcgacaaggtcatcgacgtcaccgccgctttgagacgcttcgagccgcgcgtgttgacc
ctctacgagcacgacggcctcatgttctcggaaccgagcgaggtgctccatcagctcgtc
ggcggccgtcgcgagccgatcccgctgacagaggggcacatcgcttctgccatctactcg
gatcgcgtcatcgtggggcgcgagacgattgagatccggcacgaggcggacagccgttat
gccggcatgctgagcttcaaggagtatccggcccgcaccaggaccggcatgcttgacgcc
gtgctcaccagcccgtttgaactcattctggcgcaatccttctctttcgtctcgaaggcc
gacgcgcgcatgatcatgggccgcaagcagaaccagatggtcagcagcggcgacaaggcg
gcctcgcagatcgaggaacttgatggggcgatggacgatctggagtccaaccggttcgtg
ttcggcgagcaccacctgacgctttccgtctttgccccctcggtgaaggaactgaccgac
aatcttgccaaggcacgcgccagcatgaccagtggcggcgcagtcgtcgcgcgcgaggat
ctcggccttgaggcggcctggtgggcgcagctaccgggtaacttccgttatagggcccgg
tccggcgcgatcacgtcacggaacttcgcagcgctgtcgcccttccactcttatccgctc
ggccaaaaggacggtaacgagtggggacccgccgtcgccctgctcaagaccgcgtccggc
tcgccgtactacttcaacttccattacggcgatctcggcaacaccttcgtctgcgggccg
tccggcgccggcaaaacggtgctgctcaacttcatgctgtcgcagctagaaaagcatgat
ccgcatgtggtgttcttcgataaggacaggggagccgatctctacgtgcgcgccgccggc
ggcacctatctgcctctcaagaacggcatcccgaccggttgcacccccttaaaggccctc
gaattaacaccggagaacaaggtctttctgacacgctgggtcggcaagctggtcggctcg
gcgacgcgtgaactgagcgtgaccgaactccgcgacatttcgtccgccatcgacggcctt
gccgacctgccggtcgagcgtcggacgatcggcgcgctcaggacctttctcgacaacacg
aacccggaagggatcgcagccaggctgcggcgttgggagaggggagggccgctcggctgg
gtatttgacaacgtcatcgaggatatcggtttcggagaattcggcggtggcaaattggtc
ggctacgacatgaccgactttctcgacaacgaggaaatccgggccccgctgatggcctat
ctcttccatcgcgtcgagcaactgatcgacggccgcaggatcatcatcgttatcgacgag
ttctggaaagcgctccaggacgaagggttccgcgatctcgcgcagaacaagctcaagacg
atccgcaagcagaacggcctcatgctgtttgcgacacagagcccgcgcgacgcgatcgtc
tcgccgatcgctcacaccatcatcgagcaatgcccgacacagatcttcctgccgaactcc
cgcggcaatcatggcgactatgtcgatggcttcaagctgacggagcgcgaattcgagctg
gtcgcgcgtgagctctccattgagagccggcggttcgtgttgaagcagggacataacagc
gtcgtcgccgagctggatctcaagggcctcgacgacgaactcgccatcctctccggacga
accgccaatgtcgaacttgcggatgcgatccgtgcggaggtcggcagcaatgcaaaggat
tggcttcccgttttccagcaaagaaggagtgcgacctga

DBGET integrated database retrieval system