KEGG   Sinorhizobium meliloti GR4: C770_GR4pD1462
Entry
C770_GR4pD1462    CDS       T02405                                 

Definition
(GenBank) Aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
smeg  Sinorhizobium meliloti GR4
Pathway
smeg00230  Purine metabolism
smeg01100  Metabolic pathways
smeg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:smeg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C770_GR4pD1462
Enzymes [BR:smeg01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     C770_GR4pD1462
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AGA11565
Position
pRmeGR4d:complement(1605684..1608002)
AA seq 772 aa
MNTYERIDRDLSDRDFTVVGKSVKRSDTLEKVTGTARYAGDVALPGMLHAKMKRSNIAHA
RIRSIDTSKALALKGVKAVLTHEDVPRVLHAGSPHPRSASVTKDQYILDDRVRYWGEGVA
AVAAVSEEIAERAVALIEVEYEPLPGLFTIEAASVPGAPPIHENGLDRNQVLPPVFVTRG
DVDRGFAEADLILEREYDLGRPTPAYMEPNVCVSQWDGNGKLTMWTSTQSAFMVRGTLAE
VLGVPLNKVRVIVDHMGGGFGAKQDLFQNEFLCALLARQTGRPVKMEFSRKETFLGGRSR
HPGKIWLKQGFTKDGRIVAREARVTFNSGAYGSHGPGVTNVGTAALTSLYRCENVRLEGR
CIYTNSPIAGAFRGYGVVQTYYALDLMMDEAAEKLGFDPAEFKLMNAVREGDIAPSGHPI
VGHGLGDCIRRVMEETNWHELRRREKPETVKRRGIGIGCEMHGSSAYPGIKEQGNAIVKM
NEDGTVTLITGTAGLGTGAHTALSQIVAEELGVPFEAVSVVQGDTDIVPWDIGAFASHTT
YLGGRAAQLAAADVRRQVLEHAAPMLKTEPENLAIRDGFVVVTNGSNRSIRVSEAVGPQR
GMPAVQLVGVGTYMPTKSYSFAAHFAEVEVDTETGEVAVLEVVPVHEIGRVIHPIAAAGQ
IEGGIQQGIGHTLSEDYVIDLTDGRSLNPSFVDYKMPLSMDMPSIRTIILETAPDPGGPY
GAKGVGEDPIIAIGPAIANAIYDAIGVRFHHYPITPEQVLNALKSKANETRQ
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgaacacatatgaaaggatcgatagagacctgtccgaccgggacttcaccgtcgtgggc
aagagcgtcaagcgttccgatactctggagaaggtcacggggacggccagatatgcaggc
gacgtcgccttgcccggcatgctccacgccaagatgaagcgcagcaacatcgcgcatgcg
cgcatcaggagcatcgacacgagcaaggcgctggcgctcaagggcgtcaaggcggtgctg
acgcacgaggacgtgccgcgcgttttgcatgcgggctcaccgcatccgcgctcggcatcc
gttaccaaggatcagtacatcctggatgacagggtgcgatattggggcgagggcgtcgcc
gcagtcgctgccgtcagcgaggaaatcgctgagcgcgcggtcgcgctcatcgaggtcgag
tacgagcccttgcccggcctcttcaccatcgaagccgcatcggtgcccggcgctccgccg
atccatgagaatggtctcgaccggaaccaggtgttgccgccggtcttcgtcacccgcggc
gacgtcgacaggggtttcgccgaagcggatctgatcctcgagcgcgaatacgatctcggc
cgcccgacaccggcctatatggagcccaatgtctgtgtcagccagtgggacggcaacggc
aagctcaccatgtggacctcgacccagagcgcattcatggtccgcggcacgcttgccgaa
gtgctcggcgtgccgctgaacaaggtacgcgttatcgtcgatcacatgggcggcggcttc
ggcgcgaagcaggatctgtttcagaacgagttcctctgcgccctgctcgcgcgacagacg
gggcgtccggtcaagatggagttcagccgcaaggaaacgttcctcggcggccgctcgcga
caccccggcaagatatggctgaagcagggcttcaccaaagacggccggatcgtcgcacgc
gaagccagggtcaccttcaactccggcgcctacggctcgcacggtccaggcgtcaccaat
gtcggcaccgcagcgctgacctcgctctaccgttgcgagaatgtccggctggaaggccgc
tgcatctataccaattcgccgatcgccggcgcctttcgcggctatggtgtggttcagacc
tactatgcgctcgacctcatgatggacgaggcggccgagaagctcggcttcgacccggcc
gagttcaagttgatgaacgcggtgcgcgagggcgacatcgcaccctccgggcatccgatc
gtcggacacggcctcggggattgcatccgccgcgtcatggaggagacgaactggcacgaa
ttgcgcaggcgggagaagccggaaaccgtcaagcgccgcgggatcgggatcggctgcgaa
atgcacggatccagtgcctatccgggcatcaaggaacagggcaacgcaatcgtgaagatg
aacgaggacggaacggtgacactgatcaccggcaccgccggcctcggcaccggcgcgcat
acagcgctttcgcagatcgtcgccgaggaactcggcgtgcccttcgaagccgtctcggtc
gttcaaggggacaccgatatcgtcccctgggatatcggtgccttcgccagccacacgacc
tatctcggcggacgggcggctcagctcgcggccgccgacgtgcgcagacaagtgctcgaa
cacgccgcgcccatgctcaagaccgagcccgagaatctcgcgatccgggacggtttcgtg
gtcgtcaccaacggctccaaccgcagcatccgggtttccgaggccgtcgggccgcaacgg
gggatgccggcggtgcaactagtcggcgtaggcacctacatgccgacgaagtcctactcc
ttcgccgcccatttcgccgaagtcgaggtggacaccgagaccggcgaggtggccgttctc
gaggtcgttccggtacatgagatcggcagggtcatccatccgatcgccgcggccggacag
atcgagggtggcattcagcagggcatcggccacaccctcagcgaggattacgtcatcgac
cttaccgacggacgttccctcaatccgagcttcgtcgattacaagatgcccctgtcgatg
gacatgccgtccatccgcaccatcatcctcgagacggcaccggatcccggcggtccctac
ggtgccaagggcgtcggcgaggatccgatcatcgcgatcgggcccgccatcgccaacgcc
atctacgacgccatcggcgtccgcttccaccactacccgataacgcccgagcaggtgttg
aacgctctcaagtccaaagccaacgaaacgaggcagtga

DBGET integrated database retrieval system