KEGG   Stenotrophomonas maltophilia K279a: Smlt1287
Entry
Smlt1287          CDS       T00718                                 
Symbol
trbJ
Name
(GenBank) putative conjugal transfer protein
  KO
K20266  type IV secretion system protein TrbJ
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sml00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Smlt1287 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sml02044]
    Smlt1287 (trbJ)
Secretion system [BR:sml02044]
 Type IV secretion system
  Trb secretion system protein
   Smlt1287 (trbJ)
SSDB
Motif
Pfam: Med4 DUF4141 COG2 Cauli_AT
Other DBs
NCBI-ProteinID: CAQ44836
UniProt: B2FTD9
Position
complement(1329012..1329749)
AA seq 245 aa
MKPRMLSAALAAVLSGSLMFAQPAAALIVFDPSNFVQNMLTAIQTLQQLYNQIKQLQNEA
KMLENQARNLASLPSSVVGQLRANLALTQRLIDQAKGLAYDVARMDRDFARLYPEQYAAT
VSGDQMYRDTQERWKNTLTSLQTAMQMQAQASQNLKDDEGVLADLVGKSQSAVGALQAMQ
ATNQLLALQAKQSIQTQRLQLTQDRAASLEQARQAAAVERGREVRRRFLGTGTPYTPQSV
HFYGN
NT seq 738 nt   +upstreamnt  +downstreamnt
atgaaaccccgcatgctttccgcagccctggctgccgtgctgtccggttcactcatgttc
gcccagccggccgcggccctcatcgtgttcgatccctcgaacttcgtgcagaacatgctg
acggccatccagacgctgcagcagctctacaaccagatcaagcagctgcagaacgaggcc
aagatgctggagaaccaggcccgcaatctggcgagcctgccatccagtgtggtcggtcag
ttgcgcgccaacctcgcgctgacgcagcggctgatcgaccaggccaagggcctggcctat
gacgtggccaggatggatcgagactttgcccggctgtacccagagcagtacgccgccacc
gtgagcggcgaccagatgtaccgggacacgcaggagcgctggaagaacacgctcaccagc
ttgcagactgccatgcagatgcaggcccaggcctcgcagaacctcaaggacgacgagggt
gtgttggccgatctggtgggcaagagccagtcggccgtgggcgcgctgcaggcgatgcag
gccaccaaccagcttctggctttgcaggccaagcagtcgatccaaacgcagcgcttgcaa
ctcacgcaggatcgcgccgcgtcgctggagcaggcacggcaggccgccgcggtcgagcgc
ggccgtgaagtacggcggcgtttcctgggcaccggtacgccgtacacgccgcagtccgtc
catttctacggcaactga

DBGET integrated database retrieval system