KEGG   Stenotrophomonas maltophilia K279a: Smlt1293
Entry
Smlt1293          CDS       T00718                                 
Symbol
traG
Name
(GenBank) putative conjugal transfer protein
  KO
K03205  type IV secretion system protein VirD4 [EC:7.4.2.8]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sml00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Smlt1293 (traG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sml02044]
    Smlt1293 (traG)
Enzymes [BR:sml01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Smlt1293 (traG)
Secretion system [BR:sml02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Smlt1293 (traG)
SSDB
Motif
Pfam: T4SS-DNA_transf TrwB_AAD_bind TraG-D_C
Other DBs
NCBI-ProteinID: CAQ44842
UniProt: B2FTE5
Position
complement(1334372..1336372)
AA seq 666 aa
MQGTNVLFGQIAVVFGIVIAGVWSATQWTAATLGYQLRLGSPWFDFLGTPVYHPWRLFEW
WFFFDAYAPHVFDIGGAIAGGSGLVAVLVAIGMSIWRSRQSRLVTTYGSARWANAEDIHR
AGLDQPAGVFLGLHRQQYLRHEGPEHVLTFAPTRSGKGVGLVVPTLLSWPASAVIHDIKG
ENWSITAGWRSRFSHCLLFNPTDANSAAYNPLLEVRRGAHEVRDVQNIADILVDPEGALE
RRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPACPFELTLHRMMTTPHLGDGP
HSVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAEVTSRCDWRIADLIAAEHPVS
LYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGIARRHKLLLMLDEFPALGRLDFF
ETALAFMAGYGIRSFLIAQSLNQIDKAYGQNHSILDNCHVRVTFATNDERTAKRISETLG
TATELRAQRNYAGHRLAPWLGHLMVSRQETARPLLTPGEVMQLPPDEAVVMVSSVAPIKA
KKLRYYADSNFKRRVLPPPVLAAGRYADVPPSRADDWSGLAIPAVPAAPATEPIEGVGSA
DDGGPRRQPELSETVAYDPDLVAPAADLGLLDDDDDLPLPLPRQLDPALQRTARLASLDP
NDGIDL
NT seq 2001 nt   +upstreamnt  +downstreamnt
atgcaagggacgaacgtgctgttcggtcagatcgccgtggtattcggcatcgtgatcgct
ggcgtatggagcgccacacaatggacagccgccaccctgggctaccagctacgcctgggc
tcgccctggttcgatttcctcggcacgccggtctatcacccgtggcggctgttcgagtgg
tggttcttcttcgacgcctacgctccgcatgtctttgacatcggtggtgcgattgcgggt
ggcagcggcctggtggccgtgctggtggccatcggcatgtcgatttggcgctcgcgccag
tccaggctggtcacgacctacggctcggcgcgctgggccaacgcagaggacatccacagg
gcaggccttgaccagcctgcgggcgtgttcctcggcctgcatcgccagcagtacctaagg
cacgaaggcccggagcatgtcctgaccttcgcgcctacccgctccggcaaaggtgtcggc
ctggtggtgcccaccttgttgagctggcccgcgtccgccgtcattcacgacatcaagggc
gagaactggagcatcaccgccggctggcgctcgcgcttctcgcactgcctgctgttcaac
cccaccgatgcgaactcagcggcctacaacccgctactcgaagtccggcgcggcgcgcat
gaggtacgcgacgtgcagaacatcgcggacatcctggtcgatcccgaaggcgcgctggag
cggcgcaaccactgggagaagacttcgcacgcgctgctggtcggggccatcctgcatgtg
ctctacgcgggcgaggacaagacgttgcgcggcgtggccaacttcctgtccgatcccgcg
tgcccgttcgagctgaccctgcaccggatgatgacgacgccgcatttgggcgatgggccg
cattcggtcgtggcctcggcggcgcgcgaagtgctaaacaagagcgacaacgaacgctct
ggcgtgctgtccacggccatgagctttctcggtctgtaccgcgatcccacggtggcggag
gtcacctcgcgctgcgactggcgcatcgccgacctgatcgcggccgagcacccggtatcg
ctgtacctggtggtgccaccttcggacatctcgcggacgaagccgttgatccgcctgatc
ctcaaccagatcgggcgacgcctcaccgaatcgctcgatggctctgacggcatcgcgcgc
cgccacaagctgctgctgatgctcgatgagtttcccgcactcgggcgcctggacttcttc
gagacggcacttgccttcatggcgggctatggcatccgtagcttcctgatcgcgcagtcg
ctcaaccagatcgacaaggcctacggccagaaccattccatcctagacaactgccatgtg
cgcgtaaccttcgccaccaacgacgagcgcaccgccaaacggatctccgaaacgctgggc
acggccaccgaactgcgcgcgcaacgcaactacgcaggccaccggctcgcgccgtggctg
gggcacctgatggtgtcgcgccaggaaaccgcgcgcccgctgctgacgccgggcgaggtc
atgcagcttcctcccgacgaggccgtggtgatggtgtccagcgtggcgccgatcaaggcc
aagaagctgcgctactacgcggacagcaatttcaagcggcgcgtgctgccgccgcccgtg
cttgcggccgggcgctatgccgacgtgcctccctcgcgggccgacgactggagcgggctg
gcgattcccgccgttccggcggcaccggcgacggaacccatcgagggcgttggcagcgcc
gacgacggcggcccgcgccgtcagcccgaactctccgaaaccgtcgcctacgaccccgac
ctggttgcgcctgccgccgacctcgggttgctcgatgacgacgacgacttgccgcttccc
cttcctcgccagctcgatccggccctgcagcgcacggcccggctggcttccctcgacccc
aacgacggaatcgacctatga

DBGET integrated database retrieval system