KEGG   Schistosoma mansoni: Smp_031770.1
Entry
Smp_031770.1      CDS       T01095                                 

Definition
(RefSeq) putative tropomyosin
  KO
K10373  tropomyosin 1
Organism
smm  Schistosoma mansoni
Brite
KEGG Orthology (KO) [BR:smm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:smm04812]
    Smp_031770.1
   04147 Exosome [BR:smm04147]
    Smp_031770.1
Cytoskeleton proteins [BR:smm04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     Smp_031770.1
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Smp_031770.1
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 FPP Crescentin ERM DUF724 Laminin_II Fez1 DUF4600 DUF1664 Lebercilin BORCS7 TPR_MLP1_2 AAA_13 Spectrin Uds1
Other DBs
NCBI-GeneID: 8350461
NCBI-ProteinID: XP_018653709
GeneDB: Smp_031770.1
UniProt: P42638 G4VN74
Position
7
AA seq 284 aa
MEHIKKKMLAMKLDKENAVDEADQLEAKLREKELEMQTKDEEVAEVLKKIQQVDTDKETA
QTQLAETNTKLEETDKRATEAEAEVASLQKRIRQLEDELESTETRLQEATVKLEEASKAA
DESDRGRKVLENRTFADEERINQLEEQLKESTFMAEDADRKYDEAARKLAITEVELERAE
SRLEAAESKITELEEELRIVGNNVKSLEISEQEAAQREEAYEENIRDLTERLKAAEDRAQ
ESERLVNTLQADADRLEDELVTEKEKYKALSEELDSTFAELTGN
NT seq 855 nt   +upstreamnt  +downstreamnt
atggaacatattaaaaagaaaatgttggcaatgaaattggataaagagaatgctgtagat
gaagctgatcaattggaagcaaaattacgtgaaaaagaattagaaatgcaaactaaagat
gaagaagttgcagaagtacttaaaaaaattcaacaagttgacacggacaaagaaacggca
caaactcaattagctgaaactaatactaaattagaagaaacagataaacgagcaactgag
gccgaagctgaagtcgcctcactacagaagcgaattcgacagcttgaagatgaattggaa
tctactgagactcgtcttcaagaagctactgttaagcttgaagaagcaagtaaagctgct
gatgaaagtgatcgtggtcgtaaagtattggagaatcgtactttcgcagatgaagaacgt
atcaatcagttagaagaacaattaaaagaatctacatttatggctgaagatgctgatcga
aaatacgatgaggcggctcgtaagctggctatcacggaagtggaactcgaacgggctgag
tctcgcctggaagctgccgaaagtaaaattacagaactcgaagaagagttacgcattgtt
ggtaataatgtaaaatctttggagatatctgaacaagaggcagcccagcgtgaagaggca
tatgaagagaatatacgtgatttaactgagcgcttaaaagctgctgaggatcgagctcaa
gaatctgaacgacttgtcaatactttacaagctgatgctgatcgtcttgaagatgaattg
gtcaccgagaaagagaaatataaagcactcagtgaagaattggattcaacttttgcagaa
cttactggaaactaa

DBGET integrated database retrieval system