KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10049
Entry
HMPREF0837_10049  CDS       T01259                                 

Definition
(GenBank) type II/IV secretion system protein
  KO
K02243  competence protein ComGA
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:snc02044]
    HMPREF0837_10049
Secretion system [BR:snc02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   HMPREF0837_10049
SSDB
Motif
Pfam: T2SSE AAA_14 Rad17 SRPRB TsaE AAA_18 AAA_22 AAA AAA_23 AAA_16 Zeta_toxin AAA_29 AFG1_ATPase cobW dNK AAA_5 AAA_33 ResIII AAA_2 AAA_7 ATP_bind_1 AAA_25 RNA_helicase NTPase_1 Herpes_TK AAA_PrkA AAA_30 NACHT PduV-EutP AAA_28 APS_kinase RsgA_GTPase
Other DBs
NCBI-ProteinID: ADI68277
UniProt: D6ZN86
Position
complement(39981..40922)
AA seq 313 aa
MVQEIAQEIIRSARKKGTQDIYFVPKLDAYELHMRVGDERCKIGSYDFEKFAAVISHFKF
VAGMNVGEKRRSQLGSCDYAYDQKIASLRLSTVGDYRGHESLVIRLLHDEEQDLHFWFQD
IEELGKQYRQRGLYLFAGPVGSGKTTLMHELSKSLFKGQQVMSIEDPVEIKQDDMLQLQL
NEAIGLTYENLIKLSLRHRPDLLIIGEIRDSETARAVVRASLTGATVFSTIHAKSIRGVY
ERLLELGVSEEELAVVLQGVCYQRLIGGGGIVDFANRDYQEHQAAKWNEQIDQLLKDGHI
TSLQAETEKISYS
NT seq 942 nt   +upstreamnt  +downstreamnt
atggttcaagaaattgcacaagaaatcattcgttcagctcggaaaaaagggacgcaggat
atctattttgtccctaagttagacgcctatgagcttcatatgagggtaggagacgagcgc
tgtaaaattggtagctatgattttgaaaagtttgcagccgttatcagtcactttaagttt
gtggcgggtatgaatgtgggagaaaaaagacgtagtcaactgggttcctgtgattatgcc
tatgaccagaagatagcgtctctacgtttatctactgtaggcgattatcgggggcatgag
agtttggttatccgtttgttgcacgatgaggagcaggacctgcatttttggtttcaggat
attgaagaattaggcaagcagtacaggcaacgggggctctatctttttgctggtccggtt
gggagtggtaagacgaccttgatgcatgaattgtccaagtcactctttaaaggacagcaa
gttatgtccatcgaagatcctgtcgaaatcaagcaggacgacatgcttcagttgcagttg
aacgaagcaatcggcctaacctatgaaaatctaatcaaactttccttgcgtcatcgacca
gatctcttgattatcggagaaattcgtgacagcgagacggcgcgtgcagtggtcagagct
agtttgacaggtgcgacagtcttttcaaccattcatgctaagagtatccgaggtgtttat
gagcgtctgctggagttgggtgtgagtgaagaagaattggcagttgttttgcaaggagtc
tgctaccagagattaatcgggggaggaggaatcgttgactttgcaaacagagattatcaa
gaacaccaagcagccaagtggaatgagcaaattgaccagcttcttaaagatggacatatc
acaagtcttcaggctgagacggaaaaaattagctacagctaa

DBGET integrated database retrieval system