KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10052
Entry
HMPREF0837_10052  CDS       T01259                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc00520  Amino sugar and nucleotide sugar metabolism
snc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0837_10052 (nagA)
Enzymes [BR:snc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     HMPREF0837_10052 (nagA)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-ProteinID: ADI68280
UniProt: D6ZN89
Position
complement(42735..43886)
AA seq 383 aa
MPNYIKADQFFYPHGVRRGGYLELVDGKFGKHVEQIPEGAEVIDYTGYSIAPGLVDTHIH
GYAGVDVMDNNIEGTLHTMSEGLLSTGVTSFLPTTLTATYEQLLAVTENLGNHYKEATGA
KIRGIYYEGPYFTETFKGAQNPTYMRDPGVEEFHSWQKAANGLLNKIALAPERDGVEDFV
RTVTGEGVTVALGHSNATFDEAKKAVDAGASVWVHAYNGMRGLTHRELGMVGAMYQLPHT
YAELICDGHHVDPKACEILIKQKGTENIALITDCMTAGGLEDGDYMLGEFPVVVANGTAR
LKSTGNLAGSILKLKDGLKNVVEWGIANPHEAVMMASFNPAKSVHIDDVCGQIREGYDAD
FIVLDKDLELVATYLDGVKRYQA
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgcctaactatattaaagcggatcagtttttctacccacacggagttcgtcgaggtggt
tacttggaacttgtggacggcaagtttgggaaacatgtagagcagattcctgaaggggct
gaggtgattgactatacaggttatagcattgccccaggtcttgtggatactcatattcat
ggatatgcaggtgtagatgtgatggacaacaacattgaaggtacattgcatactatgagt
gaaggacttcttagtaccggtgttaccagtttcttacccacaactttaacagccacttat
gagcaattgcttgcagtcactgaaaatcttggaaaccattataaagaagcaacaggtgct
aagattcgtgggatttattatgaaggtccatatttcacagaaacttttaagggggcacaa
aatccaacttatatgagagacccgggtgttgaggagtttcattcttggcaaaaagcggca
aatggcttgcttaataaaattgcccttgcaccagaacgtgatggggtggaagactttgtt
cgtacagttacgggcgaaggtgtgacggttgctcttggacattcaaacgcgacttttgat
gaagccaaaaaagcagtcgatgctggagcgagtgtttgggtgcatgcctacaatggaatg
cgtgggttgactcaccgtgaattgggtatggttggagccatgtaccaattgccacatacc
tatgcagagttgatctgtgatggtcaccacgtagatccaaaggcttgcgaaattcttatc
aaacaaaaaggaacagaaaacatcgctcttatcacagactgtatgacagctgggggattg
gaagacggagattatatgttgggagaattcccagttgtcgttgcaaatggaactgcacgc
ctcaaatcgacaggtaacttggcaggttctatcctcaaactcaaagatggtttgaagaat
gtggtcgaatggggaattgcgaatccgcatgaagcagtcatgatggccagcttcaaccca
gctaaatccgttcacatcgatgacgtctgtggccaaatccgtgaaggctacgacgctgac
ttcatcgtattagataaagatttggaattggtagcaacctatctagatggcgtaaaacgt
tatcaagcataa

DBGET integrated database retrieval system