KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_10073
Entry
HMPREF0837_10073  CDS       T01259                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K18891  ATP-binding cassette, subfamily B, multidrug efflux pump
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Pathway
snc02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:snc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    HMPREF0837_10073
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:snc02000]
    HMPREF0837_10073
Transporters [BR:snc02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    HMPREF0837_10073
SSDB
Motif
Pfam: ABC_membrane ABC_tran Zeta_toxin SMC_N AAA_16 DUF87 AAA_29 AAA_22
Other DBs
NCBI-ProteinID: ADI68301
UniProt: D6ZNB0
Position
complement(69501..71195)
AA seq 564 aa
MLIQKIKTYKWQALASLLMTGLMVASSLLQPRYLQEVLGALLTGKYEAIYSIGAWLIGVA
VVGLVAGGLNVVLAAYIAQGVSSDLREDAFRKIQTFSYADIEQFNAGNLVVRMTNDINQI
QNVVMMTFQILFRLPLLFIGSFILAVQTLPSLWWVIVLMVVLIFGLTAVMMGIMGPRFAK
FQTLLERINAIAKENLRGVRVVKSFVQEKEQFAKFTEVSDELLGQNLYIGYAFSVVEPFM
MLVGYGAVFLSIWLVAGMVQSDPSVVGSIASFVNYLSQIIFTIVMVGFLGNSVSRAMISM
RRIREILDAEPAMTFKDIPDEELVGSLSFENVTFTYPMDKEPMLKVVSFTIEPGQMVGVV
GATGAGKSTLAQLIPRLFDPQDGAIKIGGKDIREVSEGTLRKTVSIVLQRAILFSGTIAD
NLRQGKGNATLFEMERAANIAQASEFIHRMEKTFESPVEERGTNFSGGQKQRMSIARGIV
SNPRILIFDDSTSALDAKSERLVQEALNKDLKGTTTIIIAQKISSVVHADKILVLNQGRL
IGQGTHADLVANNAVYREIYETQK
NT seq 1695 nt   +upstreamnt  +downstreamnt
atgctgattcagaaaataaaaacctacaagtggcaggccctggcttcgctcctgatgaca
ggcttgatggttgctagttcacttctgcaaccgcgttatctgcaggaagtcttaggcgcc
ctccttactgggaaatatgaagctatttatagtatcggggcttggttgattggtgtggcc
gtagtcggtctagttgctggtggactcaatgttgtcctcgcagcctatattgcccaagga
gtttcatccgaccttcgggaggatgccttccgtaaaattcaaaccttttcttatgctgat
attgaacaatttaatgcgggaaatctagtcgttcgaatgacaaatgatatcaaccagatt
cagaacgttgtcatgatgaccttccaaattcttttcagacttcccctcttgttcatcggt
tcgtttatcctagcggttcaaaccttaccttctctgtggtgggtgattgttctcatggta
gtcttgatttttggtttgactgctgtcatgatgggaataatggggcctcgttttgccaag
tttcaaacccttcttgagcgcatcaatgccattgccaaggaaaatttacgtggcgttcgt
gtggtcaagtcctttgtccaagaaaaagagcaatttgctaagtttacagaggtctcagac
gagcttcttggtcaaaacctttacattggttatgccttttcagtagtggaaccctttatg
atgttggttggttacggggcggtcttcctctctatttggctggtcgcgggaatggttcag
tcggatccgtctgttgttggttccatcgcttcttttgttaattacctaagccagattatc
tttaccattgttatggttggatttttgggaaattctgtcagccgtgccatgatttccatg
cgtcgtattcgagaaattcttgacgcagagccagctatgaccttcaaggatatcccagat
gaagagttggttggaagtcttagctttgaaaatgtgacctttacctatccaatggacaag
gaaccgatgctgaaagttgtgagctttactattgaacctggtcaaatggttggtgtagtt
ggagcgactggtgcaggaaagtcaaccttggctcaattgattccacgtctctttgatcca
caggacggggccattaaaatcggtggcaaggatattcgagaagtgagtgaaggaaccctg
cgtaaaacagtttccatcgttctccaacgtgccattctttttagtggaacgattgcagat
aacttgagacaggggaaggggaatgctactctatttgaaatggagcgcgcagccaatatt
gcccaggctagtgaattcattcatcgtatggagaaaacctttgaaagtccagttgaagaa
cggggaaccaatttctctggtggacaaaaacaaaggatgtcgattgcgcgtgggattgtc
agcaatccacgtattctgatttttgatgattcgacctcagccttggatgccaaatcagag
cgcttggtgcaagaagctttgaataaggacttgaaggggacgacaaccattattattgct
caaaaaattagctcggttgtccatgcagacaagatcttggttctaaatcaaggacgattg
attggtcaaggtacgcatgcagacttggttgccaacaatgccgtttaccgtgaaatctat
gaaacacagaaatga

DBGET integrated database retrieval system