KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12217
Entry
HMPREF0837_12217  CDS       T01259                                 

Definition
(GenBank) DNA-binding helix-turn-helix protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: DBD_HTH HTH_3 HTH_31 HTH_19 HTH_25 HTH_37
Other DBs
NCBI-ProteinID: ADI70445
UniProt: D6ZP99
Position
complement(2027744..2028097)
AA seq 117 aa
MRKKEDKYDFRAFGLAIKEARLKRGLTREQVGALIEIDPRYLTNIENKGQHPSIQVLYDL
VSLLHVSVDEFFLPANNLVKSTRRLQIEKYMDSFTDKELSLMESLASGINEARNIED
NT seq 354 nt   +upstreamnt  +downstreamnt
atgcgtaaaaaagaagataaatatgattttagagcctttggtttagccattaaagaagct
cgattgaaacgaggtttaactcgtgaacaagtgggagcattgattgaaattgacccacgg
tacttaactaatattgaaaataaagggcaacaccccagcatacaagttctttatgacctt
gtatcgttacttcatgtttccgttgatgaatttttcttacctgctaataacttggtaaaa
agcacccgacgattacagatagagaaatacatggatagctttacagacaaagaactatcc
ttaatggaatctttagccagcggtatcaacgaagcaagaaacatcgaagactaa

DBGET integrated database retrieval system