KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12235
Entry
HMPREF0837_12235  CDS       T01259                                 

Definition
(GenBank) putative membrane protein
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
SSDB
Motif
Pfam: DUF1146 Choline_transpo SPC12 DHHC
Other DBs
NCBI-ProteinID: ADI70463
UniProt: D6ZPB7
Position
complement(2048184..2048414)
AA seq 76 aa
MIQLLFTLSSHMLFIYVSFYLLKDLVRWEKVLKVTDENTRKVRLLVAFFSIVIGYILSSF
FISLYHLWQEALRGLL
NT seq 231 nt   +upstreamnt  +downstreamnt
atgattcaattattattcactctaagtagtcatatgctctttatttatgtgagtttttac
cttttaaaggatcttgttagatgggagaaggttttaaaagtgacagatgagaatacaaga
aaagttcgtttattagtagccttttttagcattgtcataggctacatcctgagttctttc
tttattagcctgtatcatttgtggcaagaagcgcttagaggattattataa

DBGET integrated database retrieval system