KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12249
Entry
HMPREF0837_12249  CDS       T01259                                 

Definition
(GenBank) RmuC domain protein
  KO
K09760  DNA recombination protein RmuC
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    HMPREF0837_12249
SSDB
Motif
Pfam: RmuC Apolipoprotein Baculo_PEP_C Activator-TraM Sipho_Gp157 Exonuc_VII_L
Other DBs
NCBI-ProteinID: ADI70477
UniProt: D6ZPD1
Position
complement(2058811..2060067)
AA seq 418 aa
MESLLILLLIANLAGLFLIWQRQDRQEKHLSKSLEDQADHLSDQLDYRFDQARQASQLDQ
KDLEVVVSDRLQEVRIELHQGLTQVRQEMTDNLLQTRDKTDQRLQALQESNEQRLEQMRQ
TVEEKLEKTLQTRLQASFETVSKQLESVNRGLGEMQTVARDVGALNKVLSGTKTRGILGE
LQLGQIIEDIMTPAQYEREYATVENSSERVEYAIKLPGQGDQEYVYLPIDSKFPLADYYR
LEEAYETGDKDEIERCRKSLLASVKRFARDIRNKYIAPPRTTNFGVLFVPTEGLYSEIVR
NPVFFDNLRREEQIIVAGPSTLSALLNSLSVGFKTLNIQKSADHISKTLASVKTEFGKFG
GILVKAQKHLQHASGNIDELLNRRTIAIERTLRHIELSEGEPALDLLHFQENEEEYED
NT seq 1257 nt   +upstreamnt  +downstreamnt
atggaaagtttacttattctattattaattgccaacctagctggtctctttctgatttgg
caaaggcaggataggcaggagaaacacttaagtaagagcttggaggatcaggcagatcat
ttgtcagaccagttggattaccgctttgaccaagccagacaagccagccagttagaccaa
aaagatttggaagtggttgtcagcgaccgtttgcaagaagtgcggattgaattgcaccaa
ggtctgacccaagtccgtcaagaaatgacagataatctcctccaaactagagacaagaca
gaccaacgtctccaagccttgcaggaatcaaatgagcaacgtttggaacaaatgcgccag
acggtcgaggaaaaactagaaaagaccttgcagacacgcttacaggcttcctttgagaca
gtttctaaacaactggagtctgtcaatcgtggccttggagaaatgcagacagttgcccgt
gatgtcggagctcttaacaaggttctctctggaaccaagacgcgagggattctgggagaa
ttgcaactggggcaaattattgaagacatcatgacacctgcccagtacgaacgagaatac
gcaacggttgaaaactctagtgaacgagtggagtatgccatcaagttacccggacaaggc
gaccaagaatacgtctatctgccaattgactctaagtttccactggcagattattaccgc
ttggaagaagcctatgagacaggtgacaaggatgagattgaacgctgtcgtaagtcactc
ctagcaagcgtcaagcgctttgctagggatattaggaacaagtacatagcaccacctcgg
acgaccaattttggagttttgtttgttccgacagaaggtctctactcagaaatcgtccgc
aatccggtcttctttgataatttgagacgggaagaacagattatcgttgcaggaccaagt
accctatcagcccttcttaactccctatcagttggtttcaagacccttaatatccaaaag
agtgccgaccatatcagcaagactcttgccagtgtcaagaccgagtttggcaagtttggt
ggcattctggttaaggcacaaaaacatctccaacatgcctctggcaatattgatgaacta
ttaaaccgtcgtaccatagctatcgagcggacgctccgtcacattgagttgtcagaaggc
gagcctgcgcttgatctactccattttcaagaaaatgaggaagaatatgaagattag

DBGET integrated database retrieval system