KEGG   Streptococcus pneumoniae TCH8431/19A (serotype 19A): HMPREF0837_12268
Entry
HMPREF0837_12268  CDS       T01259                                 

Gene name
ccpA
Definition
(GenBank) catabolite control protein A
  KO
K02529  LacI family transcriptional regulator
Organism
snc  Streptococcus pneumoniae TCH8431/19A (serotype 19A)
Brite
KEGG Orthology (KO) [BR:snc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:snc03000]
    HMPREF0837_12268 (ccpA)
Transcription factors [BR:snc03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    HMPREF0837_12268 (ccpA)
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_26 HTH_3 HTH_31 Trp_repressor CHASE8
Other DBs
NCBI-ProteinID: ADI70496
UniProt: D6ZPF0
Position
complement(2075724..2076764)
AA seq 346 aa
MCEIERTGKGMNADDTVTIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVIDRLDY
RPNAVARGLASKKTTTVGVVIPNITNGYFSSLAKGIDDIAEMYKYNIVLANSDEDNEKEV
SVVNTLFSKQVDGIIYMGYHLTDKIRSEFSRSRTPIVLAGTVDVEHQLPSVNIDYKQATI
DAVSYLAKENERIAFVSGPLVDDINGKVRLVGYKETLKKAGIAYSEGLVFESKYSYDDGY
ALAERLISSNATAAVVTGDELAAGVLNGLADKGVSVPEDFEIITSDDSQISRFTRPNLTT
IAQPLYDLGAISMRMLTKIMHKEELEEREVLLPHGLTERSSTRKRK
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgtgtgagatagaaaggacaggaaaaggaatgaatgcagatgatacagtaaccatttat
gatgtcgctcgtgaagcaggtgtttccatggcgacggtcagccgtgtggtcaatggcaat
aaaaatgtaaaagagaatacccgtaaaaaagtgctagaggtaattgatcgcttggattat
cgtccaaatgcagttgcgcgtggtcttgcaagtaaaaagacaaccactgtcggtgtcgtg
attccaaatattaccaatggttatttttcgagtttggctaaggggattgatgatattgca
gaaatgtacaagtacaatattgtcctagctaatagcgatgaagataacgagaaagaagtt
tctgttgtcaataccctcttttcaaagcaggtagatggcattatctatatgggttatcac
ttgacagataaaattcgctcagaattttcgcgttcacgtactccgattgttctcgcagga
actgtcgatgttgagcaccagttgccaagtgtcaatattgactataagcaagcaacaatt
gatgcagtgagttaccttgctaaagaaaatgagcgtattgctttcgttagcggtccgcta
gtggatgacatcaatggtaaggttcgtttagttggctacaaggaaaccttgaaaaaagca
ggaatcgcttatagtgagggtttggtatttgaatctaaatatagctatgatgatggttac
gccttagcagagcgtttgatttcatcaaatgcaactgcagcagttgtgacaggtgatgag
ttggcagcaggagtcttgaacggtttggctgataagggtgtttctgtgccagaagatttt
gaaattattactagtgatgattcacaaatctcacgctttacccgtccaaacttgacaacg
attgcccaacctctttatgaccttggtgccattagtatgcgtatgttgaccaagattatg
cataaggaagagttggaagaacgtgaagttctcttacctcatggtttgacagaacgtagc
tcaacacgaaaacgtaaatag

DBGET integrated database retrieval system