KEGG   Shewanella oneidensis: SO_2506
Entry
SO_2506           CDS       T00099                                 

Gene name
uvrB
Definition
(GenBank) excinuclease ABC B subunit UvrB
  KO
K03702  excinuclease ABC subunit B
Organism
son  Shewanella oneidensis
Pathway
son03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:son00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    SO_2506 (uvrB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:son03400]
    SO_2506 (uvrB)
DNA repair and recombination proteins [BR:son03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     SO_2506 (uvrB)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     Supressor
      SO_2506 (uvrB)
SSDB
Motif
Pfam: UvrB_inter UvrB Helicase_C UVR ResIII DEAD AAA_30 Kinesin AAA_33 Ish1 Microtub_bd AAA_22
Other DBs
NCBI-ProteinID: AAN55537
UniProt: Q8EE83
Position
complement(2629719..2631740)
AA seq 673 aa
MSESVFQLESQFAPAGDQPTAIAKLVDGLESGLACQTLLGVTGSGKTFTIANVIAKLGRP
TIIMAPNKTLAAQLYGEMKEFFPNNAVEYFVSYYDYYQPEAYVPASNTFIEKDASVNAHI
EQMRLSATKALLERKDVVLIASVSAIYGLGDPDSYLKMLLHLRQGDTMGQRDILKRLSEL
QYTRNDIELQRGTFRVRGEVIDIFPADSDRYAIRVELFDDEIERLSEFDPLTGQIVKRIA
RTTVYPKTHYVTPREKILEATELIKQELRERKQYLLDNNKLIEAQRIHERVQYDIEMMVE
LGYCSGIENYSRYLSGRAPGEGPPTLLDYLPADGLLVIDESHVTVPQIGAMYKGDRSRKT
TLVEYGFRLPSALDNRPLKFEEFEQLMPQTIYVSATPNSYELEKSGGEIVEQVVRPTGLL
DPELEVRPVGIQVDDLLSEVAKRVAVNERVLVTTLTKRMSEDLTEYLDEHGVKVRYLHSD
IDTVERVEIIRDLRLGKFDVLVGINLLREGLDMPEVSLVCILDADKEGFLRSERSLIQTI
GRAARNVNGKVILYADRITNSMAKAIGETERRREKQRLYNLEHGIVPKGVVKRITDVMDV
DDGREAEKGHGQASLGRVAEPKAKRYHADAAQLSHDIDKLEKQMHEHARNLEFEQAAALR
DEVKRLRELLISA
NT seq 2022 nt   +upstreamnt  +downstreamnt
gtgtcagaatctgtttttcagcttgaatcccaatttgctcccgctggtgatcagcccaca
gccatcgctaaattggttgatggcctcgaatctggcctagcttgccaaaccctattaggg
gtgacgggctctggtaagacgttcaccatcgccaatgtgatagccaagcttgggcgaccg
accattattatggcgccaaacaaaacactcgccgcacagttatatggtgagatgaaagaa
tttttccccaataatgcggtggaatattttgtctcctattacgattactatcagccagaa
gcgtatgtccccgcatccaatacctttattgaaaaagatgcctcggtaaacgcccatatt
gaacaaatgcggctctcggccaccaaagctttgctagagcgcaaggatgtggtgctgatt
gcctcggtgtcggcgatttatggtcttggcgatcccgactcttacttaaagatgttattg
cacctacgccagggcgataccatggggcagcgggatattcttaaacggttaagtgaattg
caatacacccgcaatgatatcgagttgcagcgcggcacgttccgcgttcgcggtgaagtg
attgatattttccctgccgattcagatcgctacgcgattcgagtggagttatttgacgat
gagattgaacgcttaagcgagttcgatccgttaaccgggcagattgtaaagcgtatcgcc
cgcaccacagtgtaccctaagacccactatgtgacgccgcgggaaaaaatccttgaagcc
accgagctgattaaacaagagctgcgtgagcgcaagcaatatctgctcgacaataataaa
ttgattgaagcgcagcggatccacgagcgtgtgcaatatgacattgaaatgatggtggag
ctaggctattgctccggcattgaaaactactcccgttatttatcaggacgcgcccccggc
gaggggccgccaacgctactcgattacttacccgctgatggtttattggtgatcgacgaa
tcccacgttaccgtgccacaaattggtgccatgtataagggtgaccgttcccgtaaaacg
accttggtggaatatggctttcgtttgccctcggcgctggataaccggccgctgaagttt
gaagagtttgagcagttaatgccgcagacgatttatgtgtcggcgacgccaaactcctat
gaattggagaagagtggcggcgagattgttgaacaagttgtgcggcctacaggattgctc
gatcctgagcttgaggtgcgccccgtcggtattcaagtggacgatttgctctcggaagtc
gctaaacgggttgcggtaaacgagcgggtgttagtcaccacgttaactaaacgtatgtcg
gaggatttaactgaatacctcgatgaacatggtgtcaaagtccgctacttacactctgat
atcgataccgtagagcgggtagagatcattcgcgatttgcgcctcggtaagtttgatgtg
ctcgtcgggattaacttgctccgcgaaggcttagatatgccagaagtctcactcgtctgt
attttggatgcggataaggaaggctttttacgctcggaacgttcactgatccaaaccatt
ggccgtgcggcgcgcaatgtgaatggcaaggtgatcctctatgccgatcgcatcaccaac
tcgatggcaaaggcgataggtgaaaccgagcgccgacgtgagaaacagcgtctctataac
cttgagcacggtatagtgcctaaaggggtggtgaaacgcattactgatgtgatggatgtg
gatgatggcagagaggctgaaaagggtcatggtcaagcatcccttggcagagttgctgag
cctaaagcgaaacgctaccatgctgatgccgcgcagcttagccatgatatcgataagtta
gaaaaacaaatgcacgagcatgcgcgtaacttggagtttgaacaggcggcggccttgcgt
gatgaggtgaaacgcttaagggaattactgatcagcgcataa

DBGET integrated database retrieval system