KEGG   Serratia proteamaculans: Spro_4171
Entry
Spro_4171         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB
Motif
Pfam: TrbI UPF0242 Phage_Mu_Gam TFIIA GAS Filament bZIP_2 YabA Nup54 DUF4407 Mod_r Ax_dynein_light MCU Uso1_p115_C DUF3450 FPP
Other DBs
NCBI-ProteinID: ABV43265
UniProt: A8GJH5
Position
complement(4626507..4628003)
AA seq 498 aa
MADVKSNMLPKVIVVGVLAAAVVVGLKACSSNKTTEKTQQAHNVLANMSPEELRALGVEG
DTPEDTLRTLVGTLRTTRTQQAELQSNIDKVLKENEALRKRNTNVSGQVNEAVAGFQKQA
QQRQQQLQQEQQTLMGKIQTLTDQLAGNKDKAKSDSDIPLGLGLDGMGAGEGSAAPGQDG
LMWVGPKDMKEPDPRNPNSAKDGPQFPTSFLSDNAITRQKAAYEQQVKGRTNEKGAEENA
EPVFTLPENSTLVGSRAMTALLGRVPINGTVTDPYPFKLMIGKDNLTANGIELPDVEGAI
VSGTASGDWTLSCVRGQVNSITFVFADGTVRTLPHPDTNMKANSNNNSGNSGKDVSTTAG
IGWISDDNGIPCIGGERKSNASTYLPTIAALSAASAAGEGISQGQYTTQNNVNGISATMT
GNAGQAVLGKALSGGMKETADWVRERYGMMFDAVYVPPGQKLAVHITRQLAIDFETKGRK
VRYDFSLPGEDGSTGGLD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggctgatgtgaaatctaacatgctgccgaaagtgattgtggtcggcgtgctggctgcg
gccgtggttgttgggctgaaagcctgcagcagcaataaaacgacggagaaaactcagcag
gcacataacgtgctggccaatatgtcgccggaggagttgcgcgccttgggcgttgaaggg
gacacgcctgaagacacgttgcgcaccctggtcggcaccctgcgtaccacccggacccaa
caggctgagctgcaaagcaacattgacaaagtattgaaagaaaacgaagcgctgcgcaaa
cgcaataccaatgtctccggccaggtcaatgaggctgtggccggtttccagaagcaggca
cagcaacgtcagcagcagcttcagcaggagcaacaaacgctgatggggaaaatccagacg
ctgaccgatcaattggccgggaacaaagacaaggcgaagagcgacagtgatattccgctc
ggtctggggctggatggcatgggcgccggcgaaggaagcgcggcacctggccaggatggt
ttgatgtgggtcggaccgaaggacatgaaagaacctgatccgcgcaatccgaacagcgcc
aaagacggcccgcagttcccgacgtcgttcctgtctgataacgccatcacgcgccagaaa
gccgcctatgagcagcaggtgaagggacgtaccaatgaaaaaggagcggaggagaatgcc
gagccggtgtttaccctgcctgagaactccacgctggtcggtagccgcgcgatgacggcg
ctgctgggccgggtgccgatcaacggcacggtaaccgacccctatccgttcaaactgatg
attggcaaagacaacctgacggcgaacggcatcgagctgccggacgtggaaggggcaatt
gtctccgggacggccagcggtgactggacgttgtcgtgcgtgcgtggccaggtcaacagc
atcacctttgtgtttgcagacggtacggtgcgcaccttgccgcatcctgacaccaacatg
aaagccaacagtaacaacaatagcggtaacagtggcaaagacgtcagcaccacggccggt
atcggctggatctccgatgacaacggcattccgtgtatcggcggggagcgtaaatccaat
gcttcgacctatctgccgaccattgccgcgttgtctgccgccagcgctgccggtgagggg
atcagccaggggcaatacaccacacaaaacaatgtgaatggcatcagcgccaccatgacc
ggtaatgccggccaggcggtgctgggcaaagccctgtccggtgggatgaaagagaccgcc
gattgggtacgcgagcgctacggcatgatgttcgacgccgtctacgtccctccgggccag
aaactggccgtacacattacccgccaactggcgatcgattttgagaccaaagggcgcaag
gtgcgttacgacttcagcctgccaggcgaagacggcagcaccggcggactggattaa

DBGET integrated database retrieval system