KEGG   Serratia proteamaculans: Spro_4171Help
Entry
Spro_4171         CDS       T00595                                 

Definition
(GenBank) conserved hypothetical protein
Organism
spe  Serratia proteamaculans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0242 TrbI Phage_Mu_Gam GAS Filament OmpH bZIP_2 Nup54 YabA DUF4407 Mod_r Ax_dynein_light MCU DUF3450
Motif
Other DBs
NCBI-ProteinID: ABV43265
UniProt: A8GJH5
Position
complement(4626507..4628003)
Genome map
AA seq 498 aa AA seqDB search
MADVKSNMLPKVIVVGVLAAAVVVGLKACSSNKTTEKTQQAHNVLANMSPEELRALGVEG
DTPEDTLRTLVGTLRTTRTQQAELQSNIDKVLKENEALRKRNTNVSGQVNEAVAGFQKQA
QQRQQQLQQEQQTLMGKIQTLTDQLAGNKDKAKSDSDIPLGLGLDGMGAGEGSAAPGQDG
LMWVGPKDMKEPDPRNPNSAKDGPQFPTSFLSDNAITRQKAAYEQQVKGRTNEKGAEENA
EPVFTLPENSTLVGSRAMTALLGRVPINGTVTDPYPFKLMIGKDNLTANGIELPDVEGAI
VSGTASGDWTLSCVRGQVNSITFVFADGTVRTLPHPDTNMKANSNNNSGNSGKDVSTTAG
IGWISDDNGIPCIGGERKSNASTYLPTIAALSAASAAGEGISQGQYTTQNNVNGISATMT
GNAGQAVLGKALSGGMKETADWVRERYGMMFDAVYVPPGQKLAVHITRQLAIDFETKGRK
VRYDFSLPGEDGSTGGLD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtgaaatctaacatgctgccgaaagtgattgtggtcggcgtgctggctgcg
gccgtggttgttgggctgaaagcctgcagcagcaataaaacgacggagaaaactcagcag
gcacataacgtgctggccaatatgtcgccggaggagttgcgcgccttgggcgttgaaggg
gacacgcctgaagacacgttgcgcaccctggtcggcaccctgcgtaccacccggacccaa
caggctgagctgcaaagcaacattgacaaagtattgaaagaaaacgaagcgctgcgcaaa
cgcaataccaatgtctccggccaggtcaatgaggctgtggccggtttccagaagcaggca
cagcaacgtcagcagcagcttcagcaggagcaacaaacgctgatggggaaaatccagacg
ctgaccgatcaattggccgggaacaaagacaaggcgaagagcgacagtgatattccgctc
ggtctggggctggatggcatgggcgccggcgaaggaagcgcggcacctggccaggatggt
ttgatgtgggtcggaccgaaggacatgaaagaacctgatccgcgcaatccgaacagcgcc
aaagacggcccgcagttcccgacgtcgttcctgtctgataacgccatcacgcgccagaaa
gccgcctatgagcagcaggtgaagggacgtaccaatgaaaaaggagcggaggagaatgcc
gagccggtgtttaccctgcctgagaactccacgctggtcggtagccgcgcgatgacggcg
ctgctgggccgggtgccgatcaacggcacggtaaccgacccctatccgttcaaactgatg
attggcaaagacaacctgacggcgaacggcatcgagctgccggacgtggaaggggcaatt
gtctccgggacggccagcggtgactggacgttgtcgtgcgtgcgtggccaggtcaacagc
atcacctttgtgtttgcagacggtacggtgcgcaccttgccgcatcctgacaccaacatg
aaagccaacagtaacaacaatagcggtaacagtggcaaagacgtcagcaccacggccggt
atcggctggatctccgatgacaacggcattccgtgtatcggcggggagcgtaaatccaat
gcttcgacctatctgccgaccattgccgcgttgtctgccgccagcgctgccggtgagggg
atcagccaggggcaatacaccacacaaaacaatgtgaatggcatcagcgccaccatgacc
ggtaatgccggccaggcggtgctgggcaaagccctgtccggtgggatgaaagagaccgcc
gattgggtacgcgagcgctacggcatgatgttcgacgccgtctacgtccctccgggccag
aaactggccgtacacattacccgccaactggcgatcgattttgagaccaaagggcgcaag
gtgcgttacgacttcagcctgccaggcgaagacggcagcaccggcggactggattaa

DBGET integrated database retrieval system