KEGG   Schizosaccharomyces pombe (fission yeast): SPCC10H11.01
Entry
SPCC10H11.01      CDS       T00076                                 

Symbol
prp11
Name
(RefSeq) ATP-dependent RNA helicase Prp11
  KO
K12811  ATP-dependent RNA helicase DDX46/PRP5 [EC:3.6.4.13]
Organism
spo  Schizosaccharomyces pombe (fission yeast)
Pathway
spo03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:spo00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    SPCC10H11.01 (prp11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:spo03041]
    SPCC10H11.01 (prp11)
Enzymes [BR:spo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     SPCC10H11.01 (prp11)
Spliceosome [BR:spo03041]
 Complex A
  U2 snRNP components
   U2 related factors
    SPCC10H11.01 (prp11)
 Complex B
    SPCC10H11.01 (prp11)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII CdAMP_rec
Other DBs
NCBI-GeneID: 2538936
NCBI-ProteinID: NP_587856
PomBase: SPCC10H11.01
UniProt: Q9P7C7
Position
III:519540..522584
AA seq 1014 aa
MSRRTRSRSPPRRSYNRERRDYRKYDDSEDQKGARYNRYVDDVSSRRDRHDSFRSHESNK
IRRDNSWKHDKYSYEKRYQERDREYARSKNIPDQYIGRSPRPTSHRHAEEKEVDNKTKSD
ETNPVLQGSATEIKPQPRRSRFDRTERVGASLSVSEIQSENPRVDVIPKDKAVENNHQRN
AEKPVASDKITDAKLLARLERVRAWKESKAKQEASKKEEHKLNTKPQVTAKDQNAMPSTG
ISGFEINRQKDTSDMKRNNRVHMDDEDGPRRMNLEDYQELWDQEDRGMLGNEQAASMEED
EVDPLDAYMASLVGTTDTIRPGLLNTEVIDPNANDDERMVISETLEEEENLLALAAKRSK
KKDVITVDHSKINYEDFKKDFYVEPEELKNLSPAEVDELRASLDGIKIRGIDCPKPVTSW
SQCGLSAQTISVINSLGYEKPTSIQAQAIPAITSGRDVIGVAKTGSGKTIAFLLPMFRHI
KDQRPLKTGEGPIAIIMTPTRELAVQIFRECKPFLKLLNIRACCAYGGAPIKDQIADLKR
GAEIVVCTPGRMIDVLSANAGRVTNLHRCTYLVLDEADRMFDLGFEPQVMRIINNIRPDR
QTVLFSATFPRAMEALARKVLKKPVEITVGGRSVVASEVEQIVEVRPEESKFSRLLELLG
ELYNNQLDVRTLVFVDRQESADALLSDLMKRGYTSNSIHGGKDQHDRDSTISDYKAGVFD
VLIATSVVARGLDVKSLQLVVNYDCPNHMEDYVHRVGRTGRAGHTGVAVTFITPEQEKYA
VDIAKALKMSKQPVPKELQTLASQFLEKVKAGKEKAAGGGFGGKGLSRLDETRNAERKMQ
RKAYGEDEEDVETEAEAKSPLEKITPEKSTGDPTLDRVRAAVGGIAARAFANQTAQSNKL
TQPISIIKTDGDEYKAKMEINDYPQQARWAVTNNTNIVHVTELTGTSITTKGNFYLPGKN
PEPGEEKLYLWIEGPSELVVNRAITELRRLLLEGINHSLEGGNKPSASGRYTVV
NT seq 3045 nt   +upstreamnt  +downstreamnt
atgtctagaagaacacgatcaaggtcgcctccaaggcgatcctacaatagagaaagaaga
gattaccgaaaatatgatgactctgaagatcaaaagggtgcacggtataaccgatacgta
gacgatgtatcaagtcgacgagataggcatgattcttttcgttctcacgagtctaataaa
attagaagagataattcttggaagcatgataagtatagttacgaaaaaaggtatcaagag
cgagatcgagagtatgcgagatcaaagaatattcccgatcagtatattggtaggtcaccg
cgaccaacatctcatagacatgctgaggaaaaagaagtagacaataaaactaaatcagat
gaaacaaatcctgtattacaaggttccgcaactgaaataaagcctcagcctagacgttct
cgatttgatcgaactgagagagttggtgcttctttaagtgtttcagaaattcaatctgaa
aatccacgagttgatgtaattcccaaggataaagctgttgaaaataatcatcaacgaaat
gctgaaaagccagtagcgtcagacaaaattacggatgctaagctactcgccaggctagaa
cgagttagagcgtggaaagagtcaaaggcaaaacaggaggcttccaagaaggaggagcac
aagttgaatacaaagccgcaggttacagccaaagaccagaatgctatgccttcaactggt
atatccgggtttgagattaatcgccaaaaagatacttcggatatgaagcgaaataaccga
gttcacatggatgatgaagatggtcctaggcgtatgaatcttgaagactaccaggagctt
tgggaccaagaagaccggggtatgctaggaaatgagcaagcagctagcatggaggaagac
gaagtagatcctttagatgcttacatggcctctttggttggtaccactgataccataagg
cctggtttattaaatacggaggtcattgatccgaatgcaaacgatgacgagcgcatggta
atttcagagactttggaagaggaagaaaatttacttgctcttgctgcaaaacgatcaaaa
aagaaagacgtaatcacagttgatcactcaaaaataaattatgaagatttcaaaaaggat
ttctatgttgaacctgaagagctcaaaaatctgtcaccagctgaagttgatgaactacgg
gcttctttagatggtattaaaattcgtggtattgattgcccgaagccagttactagttgg
agtcaatgtggtttatctgcccaaaccataagcgtgatcaattccttgggatacgaaaaa
ccaacctctattcaagcacaagcaattccagcgattacttctggcagagatgtaattggc
gtagctaaaacaggaagtggaaaaaccattgcttttcttcttcctatgtttcgacacatc
aaagatcagcgcccattaaaaacaggagagggtcctattgcaataataatgactcctact
cgtgaattggctgtgcaaatttttcgcgaatgtaaacctttcttaaagttattgaacatt
cgtgcgtgttgtgcatatggaggtgcccctattaaagaccaaattgctgatttaaaacgc
ggtgcagaaatcgtagtttgtactcctggacgtatgattgatgttttaagtgcgaatgca
ggacgtgttactaacttacaccgctgcacttatttggttttggatgaggccgatcgtatg
tttgatttaggatttgaaccgcaagtcatgagaattattaacaatattcgacctgatcgg
caaaccgtactattttcagctacctttcctcgtgctatggaagcccttgcaaggaaagtt
ttaaagaaacctgtagagattacggttggcggacggtcggttgttgcttctgaggttgag
caaatcgttgaagtacggcctgaggaaagcaagttttctcggctattagagctgttaggt
gagttgtacaacaatcaacttgatgtacgtacacttgtttttgtggatagacaagagtct
gcggatgcacttttgtcggaccttatgaaacgcgggtatacaagtaattcaattcatggc
ggtaaggatcaacacgatcgcgactcaaccatcagtgattataaagcaggagtatttgat
gtattaatcgcaactagtgtagttgctcgtgggcttgacgttaaatctttacagctggtg
gtaaattatgattgccctaatcatatggaggattacgtgcatcgtgttggtcgtacaggc
cgtgctggccatactggtgtagctgttacctttataaccccagaacaggaaaagtacgcc
gtagacattgccaaggctttaaagatgagtaaacaaccagttccaaaagaactacaaact
cttgcttcccaattcctcgagaaagttaaggctggtaaagagaaagcagcgggtggaggt
tttggcggcaaagggttatcacgactggatgaaactcgaaatgctgagcgtaaaatgcag
cgtaaggcctatggtgaggacgaggaagatgtagagactgaagctgaagcaaaaagcccg
ttggaaaagattactcctgaaaaatctaccggtgatcccacgctcgatagagttcgtgct
gctgtgggtggaattgctgctcgtgcatttgccaaccaaactgcacaatctaacaagctt
actcagccaatttctataataaaaaccgatggtgatgagtataaagctaaaatggaaatt
aatgactatcctcaacaagctcgttgggccgttactaataacacaaatattgtacatgta
acggagttaactggcacaagtatcactactaagggtaatttctacttgccaggtaaaaac
cctgaaccaggagaggaaaagttgtacttgtggattgaaggtccatctgagcttgttgtt
aaccgagccatcactgaattgagacggcttcttcttgaaggaattaaccacagtttggaa
ggaggtaacaaaccaagtgcttctggacgatacacagttgtctag

DBGET integrated database retrieval system