KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr0812
Entry
spr0812           CDS       T00060                                 

Symbol
ABC-NBD
Name
(GenBank) ABC transporter ATP-binding protein - unknown substrate
  KO
K19083  bacitracin transport system ATP-binding protein
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Pathway
spr02010  ABC transporters
spr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    spr0812 (ABC-NBD)
  09132 Signal transduction
   02020 Two-component system
    spr0812 (ABC-NBD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spr02000]
    spr0812 (ABC-NBD)
Transporters [BR:spr02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Bacitracin transporter
    spr0812 (ABC-NBD)
SSDB
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_29 AAA_16 SMC_N NACHT MMR_HSR1 AAA_30 AAA_22 DUF5906 AAA_23 Rad17 Rad51 ATP-synt_ab ATPase_2 AAA_25 FtsK_SpoIIIE NTPase_1 RNA_helicase Dynamin_N AAA_18 AAA_28
Other DBs
NCBI-ProteinID: AAK99616
UniProt: Q8DQ77
Position
813563..814378
AA seq 271 aa
MHYDASYISFDGILRKEILMTLLDVKHVQKIYKTRFQGNQVEALKDIHFTVEKGDYVAIM
GESGSGKSTLLNILAMLDKPSRGQVYLNGTDTATIKNSQASSFRREKLGFVFQDFNLLDT
LSVKDNILLPLVLSRRPITEMMKKLVVTAENLGINQLQEKYPYEISGGQKQRVAVARAII
TEPEILLADEPTGALDSKSSAALLDVFDEINERGQTILMVTHSTAAASRAKRVLFIKDGI
LYNQIYRGEKTERQMFQEISDTLTVMASEVN
NT seq 816 nt   +upstreamnt  +downstreamnt
atgcactatgatgcaagctacatttcatttgatgggatattaagaaaggagattctcatg
acacttttagatgtaaaacacgttcaaaaaatttataaaacacgttttcagggcaaccaa
gtagaagccctcaaggatattcactttaccgtcgaaaagggtgactacgttgccatcatg
ggtgagtctggttctggtaaatcaactcttctcaatattctagctatgctggataaacca
agtcgtggtcaggtttacttgaatggaactgacaccgcaaccattaaaaattcacaggcc
tctagcttccgtcgtgaaaagttgggctttgtcttccaagactttaacttgctagatact
ctatctgtaaaggacaatatcttgcttccgcttgtcttgtcaagaagacctattacagag
atgatgaagaaattggtggtgacagctgagaatctgggaataaaccaattacaagagaag
tacccttacgagatttctggtggtcagaaacagcgtgtagcagtagcccgcgccatcatc
acagaacctgaaattctccttgcggacgaaccgacaggagctcttgactccaagtcatct
gcagccttacttgatgtctttgatgaaatcaatgagcgcggccaaaccattctcatggta
acccactcaacagcagcagctagcagagctaaacgtgtactctttatcaaagacggcatt
ctttacaatcaaatctaccgtggagagaagacagaacgtcagatgttccaagaaatctct
gataccttgactgtcatggcaagcgaggtgaattag

DBGET integrated database retrieval system