KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0602
Entry
SPs0602           CDS       T00119                                 
Name
(GenBank) putative P1-type antirepressor (phage associated)
  KO
K07741  anti-repressor protein
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Brite
KEGG Orthology (KO) [BR:sps00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    SPs0602
SSDB
Motif
Pfam: ANT AntA Peptidase_C3 Bro-N
Other DBs
NCBI-ProteinID: BAC63697
Position
628626..629354
AA seq 242 aa
MNNLITVTLNENQEPIVSGRDLHQALEIKTQYTKWLERMSDYGFEENEDYVAISQKRLTA
QGNQTEYTDHVLKLDMAKEIAMLQRNEKSKQVRKYFIQIEKDFNSPEKIMARALLMADKK
VHKLEAQIEADRPKVLFADAVSASKSSCLIGELAKILKQNGVNIGQNKLFQWLRANGYLI
SRRGESWNQPTQKSMQLGLFELKKTAINHSDGHTTTNVTPKVTGKGQQYFINKFFNQEYL
PV
NT seq 729 nt   +upstreamnt  +downstreamnt
atgaataatcttatcacagtaacactaaacgaaaaccaagaacctattgtttctggtcga
gatttgcatcaagcattagaaattaaaactcagtacacaaaatggttagaacgaatgtct
gattatgggtttgaagaaaatgaagactatgtagctattagtcaaaaaagactaacagct
cagggcaatcaaacagaatatacagaccacgttctaaaactagacatggctaaagaaatt
gcgatgcttcaacggaacgaaaagtctaaacaagtccgcaaatactttatccaaatcgaa
aaagacttcaacagccctgagaaaatcatggcaagggcgttgctgatggcggataagaaa
gtgcataaacttgaagcacaaatcgaggcagaccgtcccaaagtactatttgctgatgct
gtaagtgctagcaaatcatcttgtctgattggtgagttagctaaaatcctgaaacagaat
ggagtcaatattggtcagaataagctatttcagtggttacgagccaacggctacctaatc
agtcgccgtggtgagtcttggaatcagccaacgcaaaaaagtatgcagcttggattgttt
gaactcaaaaaaacagccatcaatcactctgacggtcacactacaacaaatgtaacccca
aaagttactggtaaagggcaacaatactttattaataaattctttaaccaggaatatctg
ccagtttag

DBGET integrated database retrieval system