KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100891692
Entry
100891692         CDS       T01019                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spu03036]
    100891692
Chromosome and associated proteins [BR:spu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100891692
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank EHD_N
Other DBs
NCBI-GeneID: 100891692
NCBI-ProteinID: XP_003723312
Position
Unknown
AA seq 497 aa
MSKVAMESSSRINTTGSKYTVATGTGAVPSTSTSKRSRKAALGGDEFMAAAIGDTAWLRQ
TLKEGKNPANFDKNGLSAIHLAALHGRMECLKLLVEKYHVSVNLASSTGWRPIHLCINSR
TGKRALECLQYLLDAGADPSAPNEDLMTPTHQAAIEGSVKCMAALLAGGGDISTPDCNGH
LPLDYAKIWGHRKCARILASETWKREKEAELTKVTELQQLKNLKDAVDGWEEQDQQAYKN
IQSEASFSEWMDKKGISDKQSPRLVSHKKESATLGAMANQLYQANSPRKANVPSVKLQAV
TEKTTGKGKAAGSKGKTQTKSAAAPAKSPGAERVAPRERLCKGKTKPKLEPVPKVKVPIL
QITGEQNEDKVNLYMQPVPDLSQEVIDRILLEKLSPHERPLSFKCKNIIDAQHRRLYDSS
VKPLEEVYAHLSNDKSSTLFPGVSNGGSSAASTRTSSTSSKDSFDNQRIADALKHIAKPY
KFPQMQGEDFTYGFEVL
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgtcgaaggttgcaatggaatctagctcccgaattaacacaacgggatcaaaatacacg
gtagccactggcacaggcgccgttccatccacctccacttcgaagcggagtcgcaaggcg
gcgcttggaggagatgaattcatggcagcggcaatcggagatacagcctggctgaggcag
acactcaaggaagggaaaaacccagcaaattttgacaaaaatggtttgtctgctattcac
ctggcagctctacatggcagaatggaatgcctgaaacttctggtagagaagtatcacgtg
agtgtgaacctggccagttctacgggctggagaccgatccatctctgtatcaacagcagg
actggaaagagagctctggaatgcctgcagtatctcctggatgcgggcgctgatccatct
gcccctaatgaagatttgatgacccccacccatcaagctgctattgaaggaagtgtgaag
tgcatggcagctcttcttgctggaggcggggatatcagtacacctgattgcaatggccat
ctacctctagactatgctaaaatctggggacatagaaaatgtgcaagaatacttgcctca
gagacttggaagagagagaaggaggccgagttgaccaaggtgactgaattgcaacagctg
aagaatctcaaggatgctgtagatggttgggaagagcaggaccaacaggcttacaagaac
attcaatctgaagcgtcattctctgaatggatggacaagaaaggcatatcagacaaacaa
tcaccacgtcttgtctcacataaaaaggagtctgcgacactcggagccatggccaatcag
ctttaccaggctaacagtcctcgcaaagcaaatgttccctcagtcaagctacaggccgtc
actgagaagaccacagggaaaggaaaggctgcgggttccaagggaaagacgcaaaccaag
tcagcagcagcgcctgcaaagagccccggtgcagagcgtgtcgcacccagggagaggtta
tgtaaaggaaagacaaagccaaagctagaaccagtaccaaaggtcaaagtccccatcctt
caaatcaccggtgagcaaaatgaagacaaagtcaacctctacatgcaacctgtgcctgac
ctatcgcaagaggtcatcgacagaatcctcttggagaagctctcgccccacgaacgccct
ctttccttcaagtgcaagaacattatcgatgctcagcacaggcgtctctacgacagcagt
gtgaaacctcttgaagaggtctatgcacatctatccaatgataaatcatcaacattgttt
ccaggagtgagcaatggtgggtcttccgccgcatccacaaggacaagtagtacctcaagc
aaggacagttttgataaccaaagaattgcagatgccttaaaacacatagccaaaccttac
aaatttcctcagatgcaaggagaagactttacatatggttttgaagtgttatga

DBGET integrated database retrieval system