KEGG   Streptosporangium roseum: Sros_2835Help
Entry
Sros_2835         CDS       T01137                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
sro  Streptosporangium roseum
Pathway
sro00740  Riboflavin metabolism
sro00790  Folate biosynthesis
sro01100  Metabolic pathways
sro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Sros_2835
   00790 Folate biosynthesis
    Sros_2835
Enzymes [BR:sro01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Sros_2835
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Sros_2835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ACZ85793
UniProt: D2B6M9
Position
3082192..3083406
Genome map
AA seq 404 aa AA seqDB search
MIKLDPIERAIADIREGKPVVVVDDENRENEGDIIFAAAKATPALLAFTIRHTSGVICVS
MRGEDLDRLGLPLMVNDNRERLRTAYTISVDARDGVSTGISASDRAKTIRTLCDSATEPF
ELVRPGHVFPLRYREGGVLVRRGHTEAAVDLARLAGLSQAGALAEVVNDDGTMKRLPELR
EFCDEHDLALVSIEQLVEFRRRSERMVTRVAETRLPNRHGMWRAYGYASALDGGEHMALV
YGDIEDGENILVRAHSECLTGDVLGSLRCDCGVQLDHAMSEIAAEGRGVVVYLRGHEGRG
IGLLAKLKAYSLQDDGRDTVDANLELGLPVDAREFSNAGQILADLGVKSVRLLTNNPAKL
RGMDGYGIKVLGREPMPVAMNPYNEKYLTAKRERLGHDIQEEKA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaagctggacccgatcgagagggcgatcgccgacattcgcgaaggcaagcccgtg
gtggtcgtcgacgacgagaaccgcgagaacgaaggggacatcatcttcgccgcggcgaag
gccacgccggcgctgctggccttcaccatccggcacaccagcggcgtgatctgcgtgtcg
atgcgcggcgaggacctcgaccggctcggcctgccgctgatggtcaacgacaaccgggaa
cgcctccgcaccgcctacacgatcagcgtggacgcccgcgacggggtgagcaccggcatc
tccgcctcggaccgggccaagaccatccgcaccctgtgcgactcggccaccgagccgttc
gagctggtacggcccggccacgtgttcccgctccgctaccgcgagggcggcgtgctggtc
cggcgcggccacaccgaggcggccgtcgacctggccaggctcgccgggctgagccaggcg
ggcgcgctcgccgaggtcgtcaacgacgacgggaccatgaagagactgccggagctgcgc
gagttctgcgacgagcacgacctggcgctggtctcgatcgagcagctcgtggagttcagg
cggcgcagcgagcggatggtgacccgggtcgccgagacgcgcctgccgaacaggcacggc
atgtggcgcgcgtacggctacgcgagcgcgctggacggcggcgagcacatggccctggtc
tacggcgacatcgaggacggcgagaacatcctggtccgcgcgcactccgagtgcctgacc
ggggacgtgctcgggtcgctgcggtgcgactgcggagtgcagctcgaccacgcgatgtcc
gagatcgccgccgagggccggggcgtggtcgtctacctgcgcgggcacgaggggcgcggg
atcggcctgctggccaagctcaaggcctacagcctgcaggacgacggccgggacaccgtg
gacgcgaacctggagctcgggctgccggtggacgcccgggagttctccaacgccgggcag
atcctcgccgacctgggcgtcaagtcggtccggctgctgaccaacaacccggccaagcta
cggggtatggacgggtacggcatcaaggtgctcggccgcgagccgatgccggtggcgatg
aacccctacaacgagaaatacctgacggccaagcgcgagcgcctcggccacgacatccag
gaggagaaggcatga

DBGET integrated database retrieval system