KEGG   Serratia plymuthica AS9: SerAS9_0295Help
Entry
SerAS9_0295       CDS       T01503                                 

Definition
(GenBank) conjugative transfer ATPase, PFL_4706 family
Organism
srr  Serratia plymuthica AS9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraC_F_IV DUF853 FtsK_SpoIIIE T2SSE AAA_7
Motif
Other DBs
NCBI-ProteinID: AEF43457
Position
340727..343591
Genome map
AA seq 954 aa AA seqDB search
MRFSLFDKKRLTRKTPVVPATGDQDTVIATEDGVPLSVDGREPLRRPGKMTVKDEKQVYH
ANPSIVDYLPWAEFLDREQCILLDDGVSVGAVFDITPVATEGRTDDRLEQMRDTVEDALQ
DSFDEHDENPWVVQFFCQDENNVEAYIDRLRNYVKPHAQGSAFTEDWLKETERHMRGIAR
PEGLFKDTLITDQPWRGQQRRTRMVVYRWIGKGNHVPMPPIAMLNQTCERVTGALAGAGV
ACVRQNGAQVHDWLLRHFNPNPEWVEKETLYRDAAYFDSRDTPEGTMPVQNDFAETLLFT
PPVSDPDQGVWWFDNQAHCAIPVEKLRRPPELGTITGEMKRGEKKINALMDLFPEGTMLC
MTIVVQPQDTLENDFNKLSKNAVGENTESGRVRQDVAQVKEYLGNRHKLYRAGITFLLRA
GDLTTLNHKRVDLTNVLLGAGLQPVRPEFDVAPLNTYLRALPMCFNPETDKKHWYTRLTW
VQHLAGLLPVTGRETGTGNPGMSFFNRGGDTLTVDPLNKHDRSQNAHMLYFGPTGAGKSA
TLCATLSQLMAIHRPRLFIAEAGNSFGLLADYFESQGLSVNKVSIKPGSGVSLPPFSYAH
KLVEDALTTLALDENDLPDIDADGDDDDDKRDYLGEMEISARMMITGGDAKEEHELKRAD
RAMIREALLMAARQTYDEGRQMLPADLQKALYTLSKDEGSDIRNEQRRAKAAEMAESLGM
FTQAGSFEAELFNREGSLWPEADVTLIDLGHLAREGYEAQMALTMVSLTNTINNIAERDQ
YSERDIVFAVDEAHIVTVNPLLAPYMTKIVKMWRKLGAWLWLATQNLKDFPDIAEKMLNM
AEWWVCLTMPPEEVNDIARFKALTEEQKAVLLSASKLSGCYTEGVVLSKKLEALFRAVPP
SLYLALGMTEKEEKAERRALMQEFGCSELEAARKVAQKLDRLRGLAANGEARAA
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttccctgtttgataaaaagcgcctgacgcgcaagacgccggtggtgccggct
acgggtgaccaggacaccgtgatcgccactgaggatggcgtgccgctgtccgtcgacggg
cgtgagccattacggcgcccgggtaagatgacggtaaaggatgagaaacaggtgtatcac
gccaacccgtccatcgttgattacctgccctgggcggagtttctcgaccgcgaacagtgt
attttgctcgatgacggggtgtccgtcggggctgtttttgacatcacgccggtagccacc
gaaggacgcacggacgatcgcctggagcaaatgcgcgacacggtggaagacgccctgcag
gactcatttgacgagcatgacgaaaacccctgggtggtgcagttcttttgccaggacgag
aacaacgtcgaggcgtatatcgaccgcctgagaaattacgtcaaaccccatgcccagggc
agcgcgttcacagaagactggctgaaagaaaccgaacgtcatatgcgcggtatcgctcgt
ccggaaggcctgtttaaggacacgctgatcaccgatcagccatggcgtgggcagcaacgt
cgtacccgcatggtggtgtatcgctggattggcaagggtaatcatgttccgatgccgccg
atcgccatgctgaatcagacctgtgagcgggtgaccggggcgctcgccggcgccggcgtt
gcctgcgtgcgccagaacggggcacaggtccatgactggctgctgcgtcattttaatccc
aacccggagtgggtggaaaaagagaccctgtaccgtgacgccgcctattttgacagtcgt
gatacgccggaaggcaccatgccggtgcagaacgattttgccgagaccctgctgttcaca
ccgcccgtgtccgatccggaccagggggtgtggtggttcgataaccaggcgcattgtgcc
attcccgtcgagaagctgcgccgcccgccggagctgggcaccatcaccggtgaaatgaaa
cgcggcgagaagaaaatcaatgcgctgatggatttgttcccggagggaacgatgctgtgc
atgaccatcgtggtacaacctcaggacacgctggagaatgatttcaacaagctgtcgaaa
aacgccgtcggcgagaataccgaatccggccgcgtgcgtcaggacgtggctcaggtgaaa
gagtacctggggaatcgccacaagctgtaccgtgccggcattacgttcctgctgcgtgcc
ggcgacctgaccacactcaaccacaaacgtgtcgatctgaccaacgtgctgctgggcgcc
ggcctgcaaccggtacggccggagtttgatgtggcgccgctcaatacctacctgcgggcg
ttaccgatgtgttttaacccggagaccgacaagaaacactggtatacccgcctgacctgg
gtacagcacctggcgggactgctgccggtgaccggccgtgagaccgggaccggtaacccc
ggtatgagcttcttcaaccgcggcggggatacgctgacggttgacccgcttaacaagcat
gaccgtagccagaatgcacacatgctgtattttggcccgaccggcgcggggaaatcggcg
acgctgtgtgcgaccttatcgcaactgatggcgatacaccggccacggttgtttatcgcg
gaagcgggcaactcgtttgggttgctggccgattacttcgagagccaggggctcagcgtc
aataaggtgagcatcaagccgggcagtggtgtctctctgccgccgttctcctatgcgcac
aagctggtcgaagatgcattaacgacgttggctctggatgaaaatgacctgccggacatc
gatgccgatggcgacgacgatgatgacaagcgcgattacctgggtgaaatggaaatctcg
gcgcgcatgatgatcactggcggtgatgcgaaggaagagcacgaactgaagcgtgccgac
cgcgcgatgatccgtgaagccttgttgatggcggcgcgtcagacctatgacgaagggcgg
cagatgttgccggcagatctgcagaaggcgttgtataccctatccaaagacgaagggagt
gatatccgtaatgagcagcgccgggccaaggcggctgaaatggccgagtcgctcgggatg
tttacccaggccggcagcttcgaggcggagctgtttaaccgcgagggtagcctgtggcca
gaggcggatgtcaccctgattgacctggggcatctggcgcgtgaggggtatgaggcgcag
atggcgctgacgatggtgagcctgaccaacaccatcaacaacattgccgaacgagaccag
tactcggagcgggacattgtgtttgcagtggatgaagcccacattgtgacggtgaacccg
ctgctggcgccctacatgaccaaaatcgtcaagatgtggcgtaaactcggtgcctggctg
tggctggcgacacagaacttaaaagacttcccggacattgccgagaagatgctgaatatg
gcggagtggtgggtctgtctgacgatgccgccggaggaggtcaacgatattgcccgtttc
aaggcgctgaccgaggagcaaaaagcggtgctgctgtcggccagcaagctgtccggttgc
tataccgagggagtggtgctgtcgaaaaaactcgaggcgctgttccgtgcggtaccgcca
agcctgtatctggccctggggatgaccgagaaagaagagaaggccgagcgccgcgcgctg
atgcaggagtttggttgtagtgagctcgaggctgcccgcaaggtggcgcaaaagcttgac
cgcctgcgcggcctggcggcgaacggggaggctcgggctgcatga

DBGET integrated database retrieval system