KEGG   Serratia sp. AS12: SerAS12_0295
Entry
SerAS12_0295      CDS       T01502                                 

Definition
(GenBank) conjugative transfer ATPase, PFL_4706 family
Organism
srs  Serratia sp. AS12
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG DUF853 FtsK_SpoIIIE T2SSE AAA_7
Other DBs
NCBI-ProteinID: AEF48409
Position
340562..343426
AA seq 954 aa
MRFSLFDKKRLTRKTPVVPATGDQDTVIATEDGVPLSVDGREPLRRPGKMTVKDEKQVYH
ANPSIVDYLPWAEFLDREQCILLDDGVSVGAVFDITPVATEGRTDDRLEQMRDTVEDALQ
DSFDEHDENPWVVQFFCQDENNVEAYIDRLRNYVKPHAQGSAFTEDWLKETERHMRGIAR
PEGLFKDTLITDQPWRGQQRRTRMVVYRWIGKGNHVPMPPIAMLNQTCERVTGALAGAGV
ACVRQNGAQVHDWLLRHFNPNPEWVEKETLYRDAAYFDSRDTPEGTMPVQNDFAETLLFT
PPVSDPDQGVWWFDNQAHCAIPVEKLRRPPELGTITGEMKRGEKKINALMDLFPEGTMLC
MTIVVQPQDTLENDFNKLSKNAVGENTESGRVRQDVAQVKEYLGNRHKLYRAGITFLLRA
GDLTTLNHKRVDLTNVLLGAGLQPVRPEFDVAPLNTYLRALPMCFNPETDKKHWYTRLTW
VQHLAGLLPVTGRETGTGNPGMSFFNRGGDTLTVDPLNKHDRSQNAHMLYFGPTGAGKSA
TLCATLSQLMAIHRPRLFIAEAGNSFGLLADYFESQGLSVNKVSIKPGSGVSLPPFSYAH
KLVEDALTTLALDENDLPDIDADGDDDDDKRDYLGEMEISARMMITGGDAKEEHELKRAD
RAMIREALLMAARQTYDEGRQMLPADLQKALYTLSKDEGSDIRNEQRRAKAAEMAESLGM
FTQAGSFEAELFNREGSLWPEADVTLIDLGHLAREGYEAQMALTMVSLTNTINNIAERDQ
YSERDIVFAVDEAHIVTVNPLLAPYMTKIVKMWRKLGAWLWLATQNLKDFPDIAEKMLNM
AEWWVCLTMPPEEVNDIARFKALTEEQKAVLLSASKLSGCYTEGVVLSKKLEALFRAVPP
SLYLALGMTEKEEKAERRALMQEFGCSELEAARKVAQKLDRLRGLAANGEARAA
NT seq 2865 nt   +upstreamnt  +downstreamnt
atgcgattttccctgtttgataaaaagcgcctgacgcgcaagacgccggtggtgccggct
acgggtgaccaggacaccgtgatcgccactgaggatggcgtgccgctgtccgtcgacggg
cgtgagccattacggcgcccgggtaagatgacggtaaaggatgagaaacaggtgtatcac
gccaacccgtccatcgttgattacctgccctgggcggagtttctcgaccgcgaacagtgt
attttgctcgatgacggggtgtccgtcggggctgtttttgacatcacgccggtagccacc
gaaggacgcacggacgatcgcctggagcaaatgcgcgacacggtggaagacgccctgcag
gactcatttgacgagcatgacgaaaacccctgggtggtgcagttcttttgccaggacgag
aacaacgtcgaggcgtatatcgaccgcctgagaaattacgtcaaaccccatgcccagggc
agcgcgttcacagaagactggctgaaagaaaccgaacgtcatatgcgcggtatcgctcgt
ccggaaggcctgtttaaggacacgctgatcaccgatcagccatggcgtgggcagcaacgt
cgtacccgcatggtggtgtatcgctggattggcaagggtaatcatgttccgatgccgccg
atcgccatgctgaatcagacctgtgagcgggtgaccggggcgctcgccggcgccggcgtt
gcctgcgtgcgccagaacggggcacaggtccatgactggctgctgcgtcattttaatccc
aacccggagtgggtggaaaaagagaccctgtaccgtgacgccgcctattttgacagtcgt
gatacgccggaaggcaccatgccggtgcagaacgattttgccgagaccctgctgttcaca
ccgcccgtgtccgatccggaccagggggtgtggtggttcgataaccaggcgcattgtgcc
attcccgtcgagaagctgcgccgcccgccggagctgggcaccatcaccggtgaaatgaaa
cgcggcgagaagaaaatcaatgcgctgatggatttgttcccggagggaacgatgctgtgc
atgaccatcgtggtacaacctcaggacacgctggagaatgatttcaacaagctgtcgaaa
aacgccgtcggcgagaataccgaatccggccgcgtgcgtcaggacgtggctcaggtgaaa
gagtacctggggaatcgccacaagctgtaccgtgccggcattacgttcctgctgcgtgcc
ggcgacctgaccacactcaaccacaaacgtgtcgatctgaccaacgtgctgctgggcgcc
ggcctgcaaccggtacggccggagtttgatgtggcgccgctcaatacctacctgcgggcg
ttaccgatgtgttttaacccggagaccgacaagaaacactggtatacccgcctgacctgg
gtacagcacctggcgggactgctgccggtgaccggccgtgagaccgggaccggtaacccc
ggtatgagcttcttcaaccgcggcggggatacgctgacggttgacccgcttaacaagcat
gaccgtagccagaatgcacacatgctgtattttggcccgaccggcgcggggaaatcggcg
acgctgtgtgcgaccttatcgcaactgatggcgatacaccggccacggttgtttatcgcg
gaagcgggcaactcgtttgggttgctggccgattacttcgagagccaggggctcagcgtc
aataaggtgagcatcaagccgggcagtggtgtctctctgccgccgttctcctatgcgcac
aagctggtcgaagatgcattaacgacgttggctctggatgaaaatgacctgccggacatc
gatgccgatggcgacgacgatgatgacaagcgcgattacctgggtgaaatggaaatctcg
gcgcgcatgatgatcactggcggtgatgcgaaggaagagcacgaactgaagcgtgccgac
cgcgcgatgatccgtgaagccttgttgatggcggcgcgtcagacctatgacgaagggcgg
cagatgttgccggcagatctgcagaaggcgttgtataccctatccaaagacgaagggagt
gatatccgtaatgagcagcgccgggccaaggcggctgaaatggccgagtcgctcgggatg
tttacccaggccggcagcttcgaggcggagctgtttaaccgcgagggtagcctgtggcca
gaggcggatgtcaccctgattgacctggggcatctggcgcgtgaggggtatgaggcgcag
atggcgctgacgatggtgagcctgaccaacaccatcaacaacattgccgaacgagaccag
tactcggagcgggacattgtgtttgcagtggatgaagcccacattgtgacggtgaacccg
ctgctggcgccctacatgaccaaaatcgtcaagatgtggcgtaaactcggtgcctggctg
tggctggcgacacagaacttaaaagacttcccggacattgccgagaagatgctgaatatg
gcggagtggtgggtctgtctgacgatgccgccggaggaggtcaacgatattgcccgtttc
aaggcgctgaccgaggagcaaaaagcggtgctgctgtcggccagcaagctgtccggttgc
tataccgagggagtggtgctgtcgaaaaaactcgaggcgctgttccgtgcggtaccgcca
agcctgtatctggccctggggatgaccgagaaagaagagaaggccgagcgccgcgcgctg
atgcaggagtttggttgtagtgagctcgaggctgcccgcaaggtggcgcaaaagcttgac
cgcctgcgcggcctggcggcgaacggggaggctcgggctgcatga

DBGET integrated database retrieval system