KEGG   Sus scrofa (pig): 100152001
Entry
100152001         CDS       T01009                                 

Gene name
COL3A1
Definition
(RefSeq) collagen alpha-1(III) chain precursor
  KO
K19720  collagen type III alpha
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04611  Platelet activation
ssc04926  Relaxin signaling pathway
ssc04933  AGE-RAGE signaling pathway in diabetic complications
ssc04974  Protein digestion and absorption
ssc05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100152001 (COL3A1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100152001 (COL3A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    100152001 (COL3A1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100152001 (COL3A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100152001 (COL3A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ssc00536]
    100152001 (COL3A1)
Glycosaminoglycan binding proteins [BR:ssc00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   100152001 (COL3A1)
SSDB
Motif
Pfam: Collagen COLFI VWC
Other DBs
NCBI-GeneID: 100152001
NCBI-ProteinID: NP_001230226
Ensembl: ENSSSCG00000016034
UniProt: F1RYI8 A0A4X1TS95
Position
15
AA seq 1466 aa
MTSFVQKGTWLLFALLHPTVILAQQQEAIEGGCSHLGQSYADRDVWKPEPCQICVCDSGS
VLCDDIICDDQELDCPNPEIPFGECCAVCPQPPTAPTRPPNGHGPQGPKGDPGPPGIPGR
NGDPGLPGQPGSPGSPGPPGICESCPTGGQNYSPQYESYDVKAGVAGGGIGGYPGPAGPP
GPPGPPGVSGHPGAPGSPGYQGPPGEPGQAGPAGPPGPPGAIGPSGPAGKDGESGRPGRP
GERGLPGPPGLKGPAGMPGFPGMKGHRGFDGRNGEKGDTGAPGLKGENGLPGENGAPGPM
GPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSP
GPSGSPGQRGEPGPQGHAGAAGPPGPPGSNGSPGGKGEMGPAGIPGAPGLMGARGPPGPP
GTNGAPGQRGAAGEPGKNGAKGEPGPRGERGEAGSPGIPGPKGEDGKDGSPGEPGANGLP
GAAGERGMPGFRGAPGANGLPGEKGPAGERGGPGPAGPRGVAGEPGRDGVPGGPGLRGMP
GSPGGPGSDGKPGPPGSQGESGRPGPPGSPGPRGQPGVMGFPGPKGNDGAPGKNGERGGP
GGPGLPGPPGKNGETGPQGPPGPTGPGGDKGDTGPPGQQGLQGLPGTSGPPGENGKPGEP
GPKGEAGAPGIPGGKGDSGAPGERGPPGAVGPSGPRGGAGPPGPEGGKGPAGPPGPPGAA
GTPGLQGMPGERGGSGGPGPKGDKGDPGGSGADGAPGKDGPRGPTGPIGPPGPAGQPGDK
GESGAPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPGQNGEPGAKGERGAPGEKGEGGPP
GIAGQPGGTGPPGPPGPQGVKGERGSPGGPGAAGFPGGRGLPGPPGSNGNPGPPGSSGPP
GKDGPPGPPGSSGAPGSPGVSGPKGDAGQPGEKGSPGPQGPPGAPGPGGISGITGARGLA
GPPGMPGARGSPGPQGVKGENGKPGPSGLNGERGPPGPQGLPGLAGAAGEPGRDGNPGSD
GLPGRDGAPGSKGDRGENGSPGAPGAPGHPGPPGPVGPAGKNGDRGETGPAGPAGAPGPA
GSRGAPGPQGPRGDKGETGERGANGIKGHRGFPGNPGAPGSPGPAGHQGAVGSPGPAGPR
GPVGPSGPPGKDGASGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGG
GAAAIAGVGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPAR
NCRDLKFCHPELKSGEYWVDPNQGCKMDAIKVFCNMETGETCISASPSTVPRKNWWTDSG
AEKKYVWFGESMNGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYME
HASGNVKKALRLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWGKTVFEYRTRKAVRLP
IVDIAPYDIGGPDQEFGADIGPVCFL
NT seq 4401 nt   +upstreamnt  +downstreamnt
atgacgagctttgtgcaaaaggggacctggttactttttgctctacttcatcccactgtt
attttggcacaacaacaggaagctattgaaggaggatgctcccatcttggtcagtcctat
gcggatagagatgtctggaagccagaaccatgccaaatatgcgtctgtgactcaggatct
gttctctgcgatgatataatatgtgatgatcaagaattagactgtcccaaccctgagatc
ccatttggagaatgttgtgcagtttgtccacaacctccaacagctcccacccgccctccc
aatggtcatggacctcaaggccccaagggagatccaggccctcctggtattcctgggaga
aatggagaccctggtcttccaggacaaccaggttcccctggttctcctgggcctcctgga
atctgtgaatcatgccctactggtggccagaactattctccccagtatgagtcatatgat
gtcaaggctggagtagcaggaggaggaatcggaggctatcctgggccagcaggtccccct
ggcccacctggtccccctggtgtatctggtcatcctggtgcccctggttctccaggatac
caagggccccctggtgaacctgggcaagctggtcctgcaggtcctccagggcctcctggt
gctataggtccatctggtcctgccggaaaagatggggagtcaggaagacccggacgacct
ggagaacgaggattgcctggccctccaggtctcaaaggtccagctggcatgcctggattc
cctggtatgaaagggcatagaggctttgatggacgaaatggagaaaaaggtgatacaggt
gctcctgggctgaagggtgaaaatggccttccaggtgaaaatggagctcctggacccatg
ggtccaagaggggctcctggtgagcgaggacggccaggacttcctggagctgcaggggct
cgaggtaatgatggtgcccgaggaagtgatggacaaccaggtccccctggtccccctgga
actgcaggattccctggttcccctggtgctaagggtgaagttggacccgcgggatctcct
ggtccaagtggatcccctggacaaagaggagaacctggacctcagggacatgccggtgct
gcaggtcctcctggccctcctgggagtaatggtagtcctggtggcaaaggtgaaatgggt
cctgctggcatccctggagctcctggattgatgggagcccgtggtcctccaggaccacct
ggtaccaatggtgctcctgggcaacgaggtgcagcaggtgaacctggtaaaaatggggcc
aaaggagagccaggaccacgtggtgaacgtggggaagctggttctccgggtattccagga
cccaagggtgaagatggcaaagatggttctcctggagaacctggtgcaaatggacttcca
ggagctgcaggagaaaggggtatgcctggattccgaggagctcctggagcaaatggcctt
ccaggagaaaagggtcccgctggcgagcgcggtggtccaggccccgcagggcccagagga
gttgccggagaacctggccgagatggtgttcctggaggtccaggattgaggggcatgccc
ggtagccccggaggaccaggcagtgatgggaaaccaggacctcctggaagtcagggagaa
agtggtcgaccaggtcctccaggctcacctggtccccgaggtcagcctggagtcatgggc
ttccctggtcctaaaggaaatgacggtgctcctggaaagaatggagaaagaggtggccct
ggaggtcccggccttccgggtcctcctggaaagaatggtgagacaggacctcagggtccc
ccaggacctactgggccaggtggtgacaaaggagacacaggaccccctggtcaacaagga
ttacaaggcttgcctggaaccagtggtcctccaggagaaaatggaaaacctggtgaaccc
ggcccaaaaggtgaagctggtgcacctggaattccaggaggcaagggtgattctggtgcc
cccggtgaacgtggacctcctggtgcagtaggtccctcaggacctagaggtggagctggc
ccccctggtcccgaaggaggaaagggccctgctggtccccctgggccgcctggtgccgct
ggtacacctggtctgcaagggatgcctggagaaagaggaggttctggaggccccggccca
aagggtgacaagggtgaccctggcggttcaggtgctgatggtgctccaggaaaagatggt
ccaaggggtcctactggtcccattggtccccctggtccagctggtcagcctggagataag
ggtgaaagtggtgcccctggacttcctggtatagctggtcctcgtggtggccctggtgag
agaggtgaacatgggccaccaggacctgccggcttccctggtgctcctggccagaacggt
gagcctggtgccaaaggagaaagaggcgctcctggtgagaaaggtgaaggaggacctcct
gggattgcaggacagcccggaggcactgggcctcctggtccccctggtccccaaggtgtc
aaaggtgaacgtggcagtcctggtggtcctggtgctgctgggttccccggtggtcgtggt
cttcctggtcctcctggcagtaacggtaacccaggcccccctggctccagtggtcctcca
ggcaaagatggtcccccaggtccacctggtagcagtggtgctcctggcagccctggagta
tctggaccgaaaggtgatgccggtcaaccaggtgaaaaaggatcacctggcccccagggc
cctccgggagctccaggcccaggtggaatttcagggattactggagcacgaggtctcgca
ggcccaccaggcatgccaggtgctaggggaagccctggcccacagggcgtcaagggtgaa
aatggaaaaccaggacctagtggtctcaatggagaacgtggtcctcctggaccccagggt
cttcctggtctggctggtgcagctggtgaacctggacgagatggaaaccctggatcagat
ggtctgccaggccgagacggagctcccggtagcaagggcgatcgtggtgaaaatggctct
cctggtgcccctggtgctcctggtcacccaggcccacctggccctgttggtcctgctgga
aagaatggtgacagaggagaaactggccctgctggtcctgctggtgctccaggtcctgct
ggttcaagaggtgctcctggtccccaaggcccacgcggtgacaaaggtgaaaccggtgaa
cgtggtgctaatggcatcaaaggacatcgaggattccctggtaatccaggtgccccaggt
tctccaggtcccgctggtcaccaaggtgcagtaggtagcccaggacctgcaggccccaga
ggacctgttggaccgagtgggccccctggcaaagatggagcaagtggacaccctggtccc
attggaccaccagggcctcgaggtaacagaggtgaaagaggatctgagggctccccaggc
catccaggacaaccaggccctcctggaccccctggtgcccctggtccatgttgtggtggt
ggggctgctgccatcgctggtgttggaggtgaaaaagctggtggttttgccccatattat
ggagatgaaccaatggatttcaaaatcaacaccgacgagattatgacttcacttaaatcc
gtcaacggacaaatagaaagcctcattagtcccgatggttctcgtaaaaaccctgctcgt
aactgcagagacctaaaattctgccatcctgagctcaagagcggagaatattgggttgat
cctaaccaaggctgcaaaatggatgctattaaagtattttgtaacatggaaactggggaa
acatgcataagtgccagtccttctactgttccacgtaagaactggtggacagattctggt
gctgagaagaaatatgtttggtttggagaatccatgaatggtggttttcagtttagctat
ggcaatcctgaacttcctgaagatgtccttgatgtccagttggcattccttcgacttctc
tctagccgagcttcccagaacatcacatatcactgcaagaatagcattgcgtacatggaa
catgccagtgggaatgtaaagaaagccttgaggctgatgggatcaaatgaaggtgaattc
aaggctgaaggaaatagcaaattcacatacaccgttctggaggatggttgcactaaacac
actggggaatggggcaagacagtcttcgaatatcgaacacgcaaggctgtgagactacct
attgtagatattgcaccctatgatattggtggtcctgatcaagaatttggtgcggacatt
ggccctgtttgctttttataa

DBGET integrated database retrieval system