KEGG   Sus scrofa (pig): 100156729
Entry
100156729         CDS       T01009                                 

Gene name
WDR5
Definition
(RefSeq) WD repeat-containing protein 5
  KO
K14963  COMPASS component SWD3
Organism
ssc  Sus scrofa (pig)
Pathway
ssc04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ssc00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100156729 (WDR5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ssc03036]
    100156729 (WDR5)
Chromosome and associated proteins [BR:ssc03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     100156729 (WDR5)
   HMT complexes
    COMPASS/SET1 complex
     100156729 (WDR5)
    COMPASS/SET1 complex (yeast)
     100156729 (WDR5)
    MLL-HCF complex
     100156729 (WDR5)
    MLL3/MLL4 complex
     100156729 (WDR5)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nup160 eIF2A WD40_like Ge1_WD40 Frtz VID27 CDtoxinA Nucleoporin_N
Other DBs
NCBI-GeneID: 100156729
NCBI-ProteinID: XP_003353752
Ensembl: ENSSSCG00000024912
UniProt: A0A480F1C4 A0A4X1SWV7
Position
1
AA seq 334 aa
MATEEKKPETEAARAQPAPSAAATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWL
ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGK
CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN
RDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKL
WDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGH
TDVVISTACHPTENIIASAALENDKTIKLWKSDC
NT seq 1005 nt   +upstreamnt  +downstreamnt
atggcaaccgaggagaagaagccggagaccgaggccgccagagcgcagcccgccccgtcg
gcggcagccacgcagagcaagcccacacctgttaaacccaactacgcgctgaagttcacc
ctggccggccacacgaaagctgtgtcctcggtgaagttcagcccgaacggggagtggctg
gcgagttcgtctgcagataaactcattaagatttggggagcttacgacggaaaatttgag
aaaaccatatctggtcacaagctgggaatatcagacgtggcctggtcgtcagactctaac
cttctcgtttctgcctcagatgacaagaccctaaagatatgggacgtgagctcggggaag
tgtctgaagaccctcaagggacacagtaattacgtcttctgctgtaacttcaacccccag
tccaacctcatcgtctcgggctccttcgacgagagcgtgaggatttgggacgtgaagaca
gggaagtgcctcaagacgctgcccgcgcactcggatcccgtctcagccgttcactttaac
cgggacggctccctgatcgtgtcgagcagctacgacggcctctgccggatctgggacacc
gcctcgggccagtgcctgaagacgctgatcgatgacgacaacccgcccgtgtccttcgtg
aagttctctccgaacggcaagtacatcctggccgcgaccttggacaacacgctgaagctc
tgggactacagcaaagggaagtgtctgaagacgtacaccggccacaagaatgagaagtac
tgcatattcgcgaatttctctgtcactggcgggaagtggatcgtgtcgggctcggaggac
aacttggtttacatctggaacctgcagacgaaagagattgtgcagaagctgcagggccac
acggacgtggtcatctcgacggcctgccaccccacagagaacatcatcgcctcggccgcg
ctggagaacgacaagaccatcaagctctggaagagcgactgctag

DBGET integrated database retrieval system