KEGG   Sclerotinia sclerotiorum: SS1G_04479
Entry
SS1G_04479        CDS       T01071                                 

Definition
(RefSeq) hypothetical protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
ssl  Sclerotinia sclerotiorum
Pathway
ssl00910  Nitrogen metabolism
ssl01100  Metabolic pathways
Module
ssl_M00531  Assimilatory nitrate reduction, nitrate => ammonia
ssl_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ssl00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    SS1G_04479
Enzymes [BR:ssl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     SS1G_04479
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Rieske NIR_SIR_ferr Rieske_2 Pyr_redox Rubredoxin_C
Other DBs
NCBI-GeneID: 5490612
NCBI-ProteinID: XP_001594671
UniProt: A7EGN7
Position
Unknown
AA seq 882 aa
MDLENYRKVHLIERNKWVLSRQLDADAGGLVVEQVRGLGLDVMLSKRVGKIEVTDENEVK
GVVFEDGEELECSTICFAIGIKARDELARQAGIKCADRGGGIVVGDDLSTSVKDIYAIGE
CASWENQTFGLIAPGIEMADVLSFNLTQAKIHAYRKFKRPDLSTKLKLLGVEVASFGDFF
ADRDGPKNLPVRAARKDKDSSDASRELTNGSRSSQVKALTYKDPFQAIYKKYLFTMDGKY
LLGGMMIGDTKDYIKLVPMVKNQKMLDVPPSQFILGASKEGDDGGDDLDDDTQICSCHNV
SKGDVVHAVKEGKCKSIGDVKSCTKAGTGCGGCMPLVTSIFNNTMKSMGQEVKNHICPHF
NYSRADLYNIISVKGLKTLAEVMKEAGNDPDSQGCEACKPSIGSIFSSLYNKHIISRPLH
GLQETNDRFLANIQRNGTFSVVPRVSAGEITPEKLILIGNVAKKYNLYTKITGGQRIDMF
GAKKQDLLAIWKELVEGGMESGHAYAKSLRTVKSCVGTTWCRYGIGDSVGMAVRLEERYK
SIRSPHKIKGGVSGCVRECAEAQNKDFGLIATEKGFNIFVGGNGGATPRHSELLAKDVPP
DNVIPILDRYLIFYIRTADKLQRTARWLEALPGGIKYLREVILEDKLGICASLEAQMEEL
VGSFFDEWAAAIHDPEIARKFKQFDNCDEEVENMEMEVDRGQMRPVYWAKESAKTDFKNV
KWTSLSWERVVKKDHFAGADDLPSGISASVKRGDTQLAVWRVRGRWLASQQMCPHKRAFV
LSDGLIGDSSSTSSSSSSTSEEAKKEESLWISCPNHKRNFNLNGKDKGRCRNDEEVSIAI
FEAEERDDGWVYLKLPPVFELDGVLGMQRWRVRAGGEWGESV
NT seq 2649 nt   +upstreamnt  +downstreamnt
atggatctggagaattataggaaagtacatcttattgagaggaataaatgggtgttaagt
cggcagcttgatgctgatgctgggggcttggtggttgagcaggtgagaggtcttggtttg
gatgttatgttatctaaacgagttgggaagattgaagtgacggatgagaatgaggtgaaa
ggtgtggtgtttgaagatggggaagagttggaatgttcgactatttgttttgcgattggt
atcaaggctcgagatgaacttgctcgtcaggcaggtatcaaatgtgctgatcgtggtgga
ggaattgttgttggggatgatttaagtacaagtgtcaaagacatctatgcgattggcgaa
tgtgctagctgggaaaatcaaacatttggtttgattgctcctggaatcgagatggcagat
gtattgtctttcaacttgacacaggcgaagatacatgcatatcgaaagtttaagcgacct
gatctcagtactaagttgaagttattgggagtagaagttgctagttttggggatttcttc
gcggatagagatgggcctaaaaatttgcctgtcagggcagcgaggaaggataaagattca
tctgatgcttcgagagagttgacgaatggatctaggtcatcgcaagtcaaggcactcact
tataaggatcctttccaagccatctacaagaagtatttgttcaccatggatggaaagtac
ttattaggtggtatgatgattggcgatacgaaagactatatcaagttggtacctatggtg
aagaatcaaaaaatgctagatgtaccacctagccaatttattcttggagccagtaaggaa
ggtgatgatggtggagatgatttggacgacgacacgcaaatatgttcgtgtcataacgtc
tccaagggtgatgtcgtccatgcggtaaaggaaggaaaatgcaaaagtatcggagacgtc
aaatcctgcacgaaagctggaaccggatgtggaggttgcatgcctttggttacgagcatc
ttcaacaacactatgaaatccatgggacaggaagtcaaaaatcatatttgtcctcatttc
aactattcacgagccgatctctacaatatcatttccgtaaagggcttgaaaactcttgcg
gaagtcatgaaggaagctggaaatgatccagatagtcaaggatgcgaggcttgtaaacct
tctatcggatcgattttcagctctttatacaacaaacatataatttcgcgtcctttgcat
ggtcttcaagaaaccaatgatcgatttttggcgaatattcaacgaaatggtactttttct
gtggtgccgagagtttctgctggagaaatcactccggagaaattaatacttataggtaat
gttgcgaagaaatataatctttacacgaaaattactggtggtcagagaatcgatatgttc
ggagctaagaaacaagatctcttggctatctggaaggagcttgttgaaggaggtatggaa
tctggtcatgcgtatgcgaagagtttgcggacagttaaaagttgtgtgggaactacttgg
tgtcggtatgggattggggattcggtgggtatggctgtgagattggaggagcgctataag
agtattaggagtccgcataaaattaagggtggtgtgagtggttgtgtgagggaatgtgcg
gaagcgcagaataaagatttcggtctcatcgccacagaaaaagggtttaatatcttcgtt
ggcggcaacggcggcgccacccctcgtcacagcgaactcctagctaaagatgttcctccc
gacaacgtaatccctatcctagatcgctacctcatattctacatccgcacggccgataaa
ctgcaacgaaccgctcgatggctcgaggctctccccggcggcatcaagtatctccgcgaa
gtaatactcgaagataaattaggaatctgcgcaagtctcgaagcacaaatggaagaatta
gtcggatcattcttcgatgaatgggcggctgctattcatgacccggaaatcgcgaggaag
tttaaacagtttgataattgtgatgaggaggtagagaatatggagatggaggttgatagg
ggacagatgagaccggtttattgggctaaggagagcgcgaagacggattttaaaaatgtt
aagtggacgtctttgagttgggagagggtggttaagaaggatcattttgcgggtgcggat
gatcttcctagtgggatttcggcgagtgtgaagaggggcgatacgcagttggctgtttgg
agagtgaggggtaggtggttggctagtcagcagatgtgtcctcataagagagcgtttgtt
ttgagtgatgggttgattggtgattctagctctacttcttcatcctcttcttcaacatcc
gaagaagcaaaaaaagaagaatccctctggatctcctgtccaaaccacaagagaaacttc
aacttaaatggaaaggataaggggagatgtagaaatgatgaggaggttagtatagctatt
tttgaagcagaggaaagagatgatgggtgggtttatttgaagttaccgccggtgtttgag
ttagatggggtattggggatgcagaggtggagggttagggccgggggagagtggggagag
tccgtttaa

DBGET integrated database retrieval system