KEGG   Saccharolobus solfataricus P2: SSO1974
Entry
SSO1974           CDS       T00054                                 

Definition
(GenBank) Conserved hypothetical protein
  KO
K07496  putative transposase
Organism
sso  Saccharolobus solfataricus P2
Brite
KEGG Orthology (KO) [BR:sso00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    SSO1974
SSDB
Motif
Pfam: OrfB_Zn_ribbon OrfB_IS605
Other DBs
NCBI-ProteinID: AAK42165
UniProt: Q97WY6
Position
complement(1786309..1787457)
AA seq 382 aa
MARRGNKAIRATVSMKIALSEPLLVLVNNYVKALRFTLFWLKENVPNPEEKGVLSKVHEA
LYEKLREEYNLPSKVAEDCYREALATYKGWYNNPRRGRFPRVYRPTVWLTPRASYNVDFE
AMTVRIVSVGELSILGYPRNLKEYMGWKMKEARLVIRDDKAFLKVVFEKEEQKVEPKESI
AVDINMAEVVVGKDDKNYVRIPTRLEEVHHWKSLAERLLKKYPRRWRENKRILYRVRSFH
LKARRIMEDFARKVGKWVVDVAKRMGVNVIKLESLKNLIKSVEKLSKEFRDKLYLMQYRR
LQYWISWQAKKRGMTVEFVNPSYSSVSCPKCGKRMVEVSHRWFKCSCGYENDRDVIAIMN
LNGRGSLTLSTAPQMRDVNPNR
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggctaggaggggtaataaagcgatcagagcaactgtttcaatgaagatcgccctctct
gaacccctcctagtcctcgtgaacaactacgttaaggcactccgtttcaccctattttgg
ttgaaagaaaatgtcccgaacccggaagagaagggagtgctttcgaaagtccacgaggcg
ttgtacgagaagttaagggaggagtacaatctaccatcaaaggttgctgaggattgctat
agggaagctctagcgacgtacaagggttggtataataatcctagaagaggacgttttcct
agagtgtacagacctacggtatggttaacaccgagggcaagttataatgtggacttcgaa
gcaatgactgttaggattgtgagtgttggcgaactttcaatcttaggttatcctagaaac
ctcaaggagtacatgggttggaagatgaaggaggctaggttagtgatcagggatgataag
gctttccttaaagttgtttttgagaaagaggagcagaaggttgagccaaaggaaagtatt
gccgtagatataaacatggctgaggtagttgtagggaaggacgataagaactacgttagg
atcccaactcgccttgaggaagttcaccactggaagtcgttagccgagaggttgctgaag
aagtatccaaggaggtggagggagaataagaggatcttgtatagagttcgttctttccat
ctaaaggctaggaggattatggaggactttgctaggaaagtggggaagtgggttgttgat
gtagcaaagagaatgggtgttaacgtcatcaaattggagagtcttaagaaccttattaag
agcgtggaaaagctatctaaggagtttagggataagttgtatcttatgcagtatcgtcgt
ttgcagtactggatttcttggcaagctaagaagcgtggaatgactgttgagtttgttaat
cctagttattcttctgtttcatgcccaaaatgcggtaaaaggatggttgaggtttctcat
cgttggtttaagtgctcatgtggttatgagaatgatcgtgacgttattgcaatcatgaat
ttaaatgggagggggtctctgaccctctcgactgcccctcaaatgagggatgtaaacccg
aaccgatga

DBGET integrated database retrieval system