KEGG   Sulfurisphaera tokodaii: STK_02380
Entry
STK_02380         CDS       T00062                                 
Symbol
hxlA
Name
(GenBank) hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00030  Pentose phosphate pathway
sto00680  Methane metabolism
sto01100  Metabolic pathways
sto01120  Microbial metabolism in diverse environments
sto01200  Carbon metabolism
sto01230  Biosynthesis of amino acids
Module
sto_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STK_02380 (hxlA)
  09102 Energy metabolism
   00680 Methane metabolism
    STK_02380 (hxlA)
Enzymes [BR:sto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     STK_02380 (hxlA)
SSDB
Motif
Pfam: OMPdecase QRPTase_C PEP_hydrolase Ribul_P_3_epim GDPD Radical_SAM
Other DBs
NCBI-ProteinID: BAB65199
UniProt: Q976E8
Position
259294..259962
AA seq 222 aa
MELLEKLLKSKNLQVALDFIDLKNAEEIAKQSIEAGADILEVGTPLIKSYGIQGIRRIRE
IAKERIVLADTKTADAGDVEAEIVHLGGGNIMTVLGIMDDATIESAVKKAHEYGILVQAD
LINVKDILKRAEEIKRLGVDIIGLHVGLDVQKKRGITISDLKNEIKKVSELGVIVSVAGG
LNKNNIVDIIDLPINIYVVGGAITRAKNPLEEAKQIVKIIKG
NT seq 669 nt   +upstreamnt  +downstreamnt
atggaattactggaaaaattattaaaaagtaaaaatttacaagtagcattagattttatc
gatttaaaaaacgcagaagaaattgcaaaacagtctattgaggctggggctgatatatta
gaagttggaacacctttaatcaagtcttatggcatacaaggaataagaagaataagggaa
attgcaaaagaaagaattgttttagctgacactaaaactgcagatgctggcgacgtagag
gctgaaatagttcatctaggtggaggtaatattatgacagtgcttggaattatggacgat
gctacaatagaaagtgcagtaaagaaagcacatgaatatggaattctcgtccaagcagat
ctcataaacgttaaagatattctaaaacgagcagaagaaattaaaagattgggggtagac
ataataggattgcatgtaggattagatgtgcagaaaaaaagaggtattactataagcgat
ttaaagaatgaaataaagaaagttagcgaacttggagtaatagtatcagttgctggcggg
ttaaacaagaataatattgttgatattatagatttacctataaatatttatgttgttggt
ggagcaataacaagagcgaagaatccattagaggaagctaagcaaatcgttaaaataatt
aaggggtaa

DBGET integrated database retrieval system