KEGG   Sulfurisphaera tokodaii: STK_02690
Entry
STK_02690         CDS       T00062                                 
Symbol
tuf
Name
(GenBank) elongation factor 1 alpha
  KO
K03231  elongation factor 1-alpha
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sto03019]
    STK_02690 (tuf)
   03016 Transfer RNA biogenesis [BR:sto03016]
    STK_02690 (tuf)
   03012 Translation factors [BR:sto03012]
    STK_02690 (tuf)
   04131 Membrane trafficking [BR:sto04131]
    STK_02690 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_02690 (tuf)
Messenger RNA biogenesis [BR:sto03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     STK_02690 (tuf)
Transfer RNA biogenesis [BR:sto03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    STK_02690 (tuf)
Translation factors [BR:sto03012]
 Eukaryotic type
  Elongation factors
   STK_02690 (tuf)
Membrane trafficking [BR:sto04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Other CMA associated proteins
    STK_02690 (tuf)
Exosome [BR:sto04147]
 Exosomal proteins
  Proteins found in most exosomes
   STK_02690 (tuf)
SSDB
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 GTP_EFTU_D4 SRPRB RsgA_GTPase Septin Gtr1_RagA
Other DBs
NCBI-ProteinID: BAB65236
UniProt: Q976B1
Position
complement(284348..285655)
AA seq 435 aa
MSQKPHLNLIVIGHVDHGKSTLVGRLLMDRGFLDEKTIKEAEEAAKKLGKESEKYAFLLD
RLKEERERGVTINLTFMRFETKKFFFTIIDAPGHRDFVKNMITGASQADAAILVVSAKKG
EYEAGMSAEGQTREHIILAKTMGINQVIVAVNKMDLTDPPYDEKRFKEIVDQVGKFMKSF
GFDMNKVKFVPVVAPTGENITQRSENMKWYTGPTLEEYLDQLEIPPKPVDKPLRIPIQEV
YSISGVGVVPVGRVETGVLKVGDKVVFMPVGKVGEVRSIETHHTKIEKAEPGDNIGFNVR
GVEKKDIKRGDVAGSLNVPPTVADEFTAQIIVIWHPTAVSVGYTPVVHIHTASVACRITE
LTSKIDPKTGKEVEKNPQFLKSGDSAIVKMKPIKELVVEKFREFPALGRFAMRDMGKTVG
VGVVIDVKPKKVEIK
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtcacaaaagccacaccttaatttaattgttataggacatgtagaccatggtaaaagc
accttagttggaagacttttgatggatagaggttttctagatgaaaaaacaataaaagaa
gcagaagaagctgcaaagaaactagggaaagaatcagaaaagtatgccttcttactagac
agattaaaagaagaaagagaaagaggtgtaacgataaacttaacctttatgagattcgag
acaaagaagttcttctttacaattattgacgcacctggtcatagagacttcgtaaagaat
atgataactggtgcaagccaagcggatgctgctatattagtagtctcagctaagaaaggt
gaatatgaagctggtatgagtgcagaaggacaaacaagagaacacataatactagcaaaa
acaatgggaataaatcaagtgatagtagctgtaaataaaatggatctaactgatccacct
tatgatgagaaaagattcaaagaaattgtagatcaagtaggtaagtttatgaaaagcttt
ggatttgatatgaacaaggttaagtttgtaccagtagttgcgccaactggtgaaaatata
acacagagatctgaaaatatgaaatggtatactggtccaacattagaagaatatttagat
caactagagataccgccaaaaccagttgataagccattaaggataccaattcaagaagta
tactcaatttctggtgtaggtgtagtcccagtaggtagagtagaaactggtgtccttaaa
gtaggtgataaagtagtatttatgccagtaggaaaggttggtgaagttagatctattgaa
actcatcatacaaaaattgaaaaagcggaaccaggtgataatattggattcaacgttaga
ggtgttgaaaagaaagatatcaaaagaggagatgttgctggtagcttaaatgttccacct
actgttgcagacgaatttacagcacaaataatagtaatatggcacccaacagctgtaagt
gttggttataccccagtagttcatatacatacagctagtgtagcttgtagaataacagaa
ctcacttcaaagattgatccaaagaccggtaaggaggttgaaaagaacccacaattccta
aagtctggtgattcagcaatagtaaaaatgaagcctataaaagagttagttgtagagaaa
ttcagagaattcccagcattaggaagatttgctatgagagatatgggtaaaacagtggga
gttggagtagttattgatgtaaaaccaaagaaggtagagattaaataa

DBGET integrated database retrieval system