KEGG   Sulfurisphaera tokodaii: STK_03300
Entry
STK_03300         CDS       T00062                                 
Symbol
pan
Name
(GenBank) proteasome-activating nucleotidase
  KO
K03420  proteasome regulatory subunit
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03050  Proteasome
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    STK_03300 (pan)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:sto03051]
    STK_03300 (pan)
Proteasome [BR:sto03051]
 Prokaryotic proteasome
  Archaeal regulatory particles
   STK_03300 (pan)
SSDB
Motif
Pfam: AAA AAA_lid_3 Prot_ATP_ID_OB_C AAA_2 AAA_16 AAA_5 RuvB_N Prot_ATP_ID_OB_N AAA_22 nSTAND3 AAA_28 DUF815 AAA_14 AAA_24 TIP49 IstB_IS21 Mg_chelatase RNA_helicase Sigma54_activat AAA_7 AAA_18 Parvo_NS1 ATPase AAA_33 LonB_AAA-LID ATPase_2 NACHT PhoH DivIC AAA_25 XhlA AAA_30 AAA_3
Other DBs
NCBI-ProteinID: BAK54240
UniProt: Q975U2
Position
complement(349843..351021)
AA seq 392 aa
MSDELDSYRAKHYNSDDPIVRLLEEKIESLTKELEKLRQDLNWYKGELEKLLAPPYIEAI
VLDILPDGKVIVRSSSGPNLIVNVSSNIDIKKLKPGSLVALTQRGSTIVEVLPEREDAYV
KSFEVIEKPNVHYSDIGGLNEQINEIREVIELPLKNPELFKEIGIDPPKGVLLYGPPGTG
KTLLAKAVATESNATFIQVVASEFAQKFVGEGARIVREVFELARRKAPSIVFIDEIDAIG
AKRVDMGTSGEREIQRTLMQLLAEIDGFKPLDNVKIIAATNRLDILDPALLRPGRFDRLI
EVPLPNFEGRKEIFRIYLQKMKTDGNIRYDILASMTEGFSGAEIKNVCTEAGYIAIRNGR
KYVNMTDLITAIEKIKAKNNKAKNTDRTEKYV
NT seq 1179 nt   +upstreamnt  +downstreamnt
ttgtctgacgaattagacagttacagagccaaacattataatagtgatgatccaatagta
agattacttgaagagaaaatagaatctctaactaaagaacttgaaaaactacgtcaagat
ttaaattggtataaaggtgaacttgaaaaactactagctcctccatatattgaagcaatt
gtattggacatactaccagacgggaaagtaatagtaagaagttcttctggacctaattta
atagttaatgtttcctcaaatattgatattaaaaagcttaaacctggctctctagtagca
ttaactcaaagaggatccactatagttgaagtattaccggaaagagaagatgcatatgta
aagtcgtttgaagttatagaaaaacctaatgttcattattctgatatcggaggattaaat
gagcaaataaacgaaataagagaagttatagaattacctttaaaaaacccagaattattt
aaagaaataggtatagatccgcctaaaggtgtattactttacggtccacctggaactggt
aaaactttactagcaaaagccgtggcaacagaaagtaatgcaacatttattcaagttgtt
gcttctgaatttgcacaaaaatttgtaggagaaggagctagaattgttagggaagtattt
gagttggcaagaagaaaagctccatcaatagtatttatagatgaaatagatgcaattggt
gctaaaagagtggatatgggaactagtggagaaagggaaatacaaaggactttaatgcaa
ttattagctgagatagatggatttaaaccattagataatgttaaaattattgccgcaaca
aacaggctagacattcttgatccagcactactgagaccaggaaggtttgataggttaatt
gaggtacctttaccgaattttgagggaagaaaggaaatatttagaatctatttgcaaaaa
atgaaaacagatggcaatattagatatgatatccttgctagcatgactgaaggatttagc
ggtgctgagattaaaaatgtgtgtactgaagcagggtatattgcaattagaaatggaaga
aagtatgttaacatgactgatttaattacagctatagaaaaaattaaagctaaaaataat
aaagctaaaaatactgacagaacagaaaagtatgtttaa

DBGET integrated database retrieval system