KEGG   Sulfurisphaera tokodaii: STK_03460
Entry
STK_03460         CDS       T00062                                 
Symbol
speE
Name
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00270  Cysteine and methionine metabolism
sto00330  Arginine and proline metabolism
sto00480  Glutathione metabolism
sto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    STK_03460 (speE)
   00330 Arginine and proline metabolism
    STK_03460 (speE)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    STK_03460 (speE)
Enzymes [BR:sto01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     STK_03460 (speE)
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_12 Methyltransf_25 Methyltransf_11 Methyltransf_2 Methyltransf_30 Methyltransf_5 Methyltransf_23 MTS Methyltransf_31 BpsA_C DUF3902
Other DBs
NCBI-ProteinID: BAB65325
UniProt: Q975S5
Position
366070..366972
AA seq 300 aa
MYEWHWHIEWQTPYEFHGHAITKVIAEEKTPYQRALLVELARFGKALILDGKIQSTITDE
FIYHEALVHPLLLSINNPEKILILGGGEGATLREVLKHKTIKNVTMVDIDPVVIDFAKKY
LQEWHQGAFDNPKSKLVIEDGYKFIKETKEKFDAVVIDLTDPIKDSPSQMLYTKEFYEEV
KRISKWGIVTQATSPSFSLETFSIIYNTIKHVFKKVSAGITYVPAFDGLWGFVYASDEVN
PAEFSKEEINNRIKERIDGSLRFYDGETHITMFSIPKHIREVLEKENKISTRENPVAVPA
NT seq 903 nt   +upstreamnt  +downstreamnt
atgtatgaatggcattggcatatagaatggcaaactccatacgaatttcatggacacgct
ataactaaagtaattgcggaagaaaaaacaccttatcagagagctcttttagttgaatta
gctagattcgggaaagcactaatattagacggaaaaatacaatctacaataactgacgag
ttcatataccatgaggcattagtacatccattacttttatctataaataatccagaaaaa
attctaatattaggagggggagaaggagcaacattaagagaagttcttaaacataaaact
ataaagaatgttactatggttgatatagatcctgtagtaatcgattttgccaaaaaatat
ttacaagaatggcatcaaggagctttcgataatcccaaaagtaaattagtcatagaggat
ggctataaatttattaaagaaacaaaagagaaatttgacgcagtagttattgatcttaca
gacccaataaaagattcgccttcccaaatgctatatactaaagagttttatgaagaagtt
aagagaataagtaaatggggtatagtaacacaagctacttctccatcatttagtttagaa
accttctccataatttataatacaataaaacatgttttcaaaaaagtaagtgctggaata
acatatgtaccggcatttgacggcttatggggatttgtatatgcttcagatgaagttaat
ccagcagaatttagtaaagaagaaattaataatagaattaaagaaagaatagatggaagt
cttagattttatgatggtgaaactcatattacaatgtttagtatcccgaaacatataagg
gaagtactagaaaaagaaaataaaatttcgactagagaaaatccagtagcagttccagca
tag

DBGET integrated database retrieval system