KEGG   Sulfurisphaera tokodaii: STK_03740
Entry
STK_03740         CDS       T00062                                 

Gene name
rgy
Definition
(GenBank) reverse gyrase
  KO
K03170  reverse gyrase [EC:5.6.2.2 3.6.4.12]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sto03032]
    STK_03740 (rgy)
Enzymes [BR:sto01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     STK_03740 (rgy)
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     STK_03740 (rgy)
DNA replication proteins [BR:sto03032]
 Prokaryotic type
  DNA Topoisomerases
   STK_03740 (rgy)
SSDB
Motif
Pfam: Topoisom_bac Toprim DEAD zf_Rg Helicase_C ResIII Sgf11
Other DBs
NCBI-ProteinID: BAK54255
UniProt: Q975P6
Position
complement(388195..391896)
AA seq 1233 aa
MNTIPSSNYLSSCPNCGRVISAERLYKGSVCSECLEEDREFNSIRELVNELSRLNKLNRL
NYIKEVLREYDIFVELFKRIIGFPPFGPQKSWIIRVLRKESFAIIAPPGLGKTTFGIITS
LYFSSKNFRSILIFPTRSLVKQAVDRISMYSNKTNIETKLLYYHSGINESQKQELYKALN
AGDFNIFIATNRFFIDKINELKNIKYDFMFVDDVDTALKSSKSAETILNLAGFSKDDILS
VKELLRKSREDESVYTKIQEIRGNKLKGKTIVFSSATLTRGNPVLSALMGFRPGSSVIYL
RKIIDTYAYLPNNDDDVVNLLKELLNKLGEGGLIFVPVDKGQEYAKFLEAKLSDSFNVVT
ITSSNTNKIEDFANGNIYALIGSATHYGILVRGIDIPWRVKYAIFVGIPKFKFKIGEVMN
LVALSRILSMIGLITKDQDIVRLAGRVRGKLRKLSPAAISMLTNQAREGKLEDETLLRAY
EVVNKYLEDKDILKKIAELGDLVISNGYILMPDYLTYIQASGRTSRIYGGELTTGLSVLL
IDDINLFNILNRKLSLILDEIIWQELQIKKNKIGSSDLTEIINKINEERERILKVKKEGE
IEPSLQKVKTVLFIVESPNKAKTISNFFAKPSIRQLENIRAFETVLEDKILIVAATGGHV
YDLTTQNIGIYGVEVQQQNSHFNFIPYYNTIKKCINGHQFTDFEQGNQCPKCHTTQIILD
KTATIDALRKLALEADEILIGTDPDTEGEKIAWDIYLALKPFNSNIKRAEFHEVTRKAIL
QAINNPRPFNVNLVKSQIVRRIEDRWIGFKLSTKLQEDFWKEYCKNYNCKSEENKNLSAG
RVQSPVLNWIVNRYDEYNANKTKIYYGSIKGIDELKFYVFKQNEKIRKNANIYVKIINTK
VLEEEINPLPPYTTDTLLYDANQFYGISASETMKIAQDLFELGLITYHRTDSTRISNTGI
SIAEGYLKQIAGENYTKIFKPRSWGEGGAHEAIRPTRPLDVDQLRLLVDEGEIELAKKIT
RAHFLIYDLIFRRFITSQLVPLKVIKERIEYKICEDSNCNSELKTLQNYSEFITDIKLPI
QLDYSKFLYLPTTRIIKNSIIKKLQETTGSTNAELVSKIQLTGSFVKSTVNLYTQAELVA
EMKRKEIGRPSTYATIISTILKRGYVIESKKTKKLIPTQLGKEVNKYLNQKFSSFVSEER
TRNLLQLMDMVEQGKQDYIQILKDIYYEIKSIR
NT seq 3702 nt   +upstreamnt  +downstreamnt
ttgaacactatcccttcatcaaattacttatcttcatgtcctaattgcggcagagtaatc
tcagctgaaagactctataaaggatccgtatgtagtgagtgtcttgaagaagatcgtgaa
tttaatagcattagagaattagtcaatgaactaagtaggttaaataaactaaatagacta
aactacataaaagaggttctaagagaatatgatattttcgttgaattatttaaaagaata
ataggctttcctccatttggacctcaaaagagttggattataagagttttaagaaaggaa
agttttgctataattgctcctccaggtttaggtaaaaccacatttggtattattacctca
ttatacttttcctcaaagaattttagatctattcttatatttcctacaagaagcttagtt
aagcaagcagtagatagaatatctatgtattctaataaaactaatatagaaacaaaactt
ttatactatcattctggcattaatgaatctcaaaaacaagagttatacaaagcactaaat
gcaggggattttaatatctttattgcaacaaatagattttttatagataaaataaatgaa
ctaaaaaacataaaatatgatttcatgtttgtagatgacgttgatacagcattaaaatct
agtaaaagtgctgaaaccatacttaatttagctggattttcaaaagatgatattttatca
gtaaaagagcttctacgaaaatctagagaagatgaatcagtatatacaaaaatccaggaa
ataagaggaaataaacttaaagggaaaactatcgtattttcgtcagcaacattaactcgt
ggtaatccagtactttctgcattaatgggctttagaccaggtagttctgtgatttatttg
agaaaaataatcgacacatatgcatatctacccaataatgatgatgatgtagtaaatcta
ttaaaagaacttctaaataagctaggtgaaggaggacttatctttgtaccagttgataaa
ggtcaagaatatgcaaaattcttggaagcaaaattgagtgatagttttaatgttgttacg
ataacctcatctaatactaataaaattgaagatttcgcaaatggtaacatatatgctcta
ataggatctgcaactcattatggaatcctagtaagaggaatagatataccttggagagtt
aagtatgctattttcgttggaattccaaaatttaagttcaagataggcgaagtaatgaat
ttagttgcattatctagaattttaagtatgataggtctaattactaaggatcaggatatt
gtaagattagctggtagagtaagaggaaaactaagaaagttaagtccagcagcaatttca
atgctaacaaatcaagctagagagggtaagcttgaggatgaaactttgcttagagcctat
gaagtcgtaaataaatacttagaagataaggatattcttaaaaagatagctgaactggga
gatctcgtaatatcaaacggctatattctcatgcctgactatcttacatatatacaagca
agcggaagaacttcgagaatatatggcggagaactaaccactgggttatctgttctctta
atagatgatattaatttattcaatatactaaacagaaaactctcattgattctggatgaa
attatatggcaagagttacaaattaaaaagaataagataggctctagtgatctaactgaa
ataataaataaaattaatgaagagagagaaagaatattaaaggtaaaaaaagagggagaa
attgaaccttcgttacagaaagttaaaacggttttatttattgtggaatcgccaaataaa
gcaaaaaccatatcaaacttctttgcgaaacctagtattagacagcttgaaaatattaga
gctttcgaaaccgttttagaagataaaatattaattgttgcagctacaggaggacatgta
tatgatttaacaactcagaacataggaatttacggtgttgaagtacagcagcagaattct
cattttaactttataccatattataatactattaagaaatgtataaatgggcatcagttt
actgattttgaacaaggaaatcagtgtcctaaatgtcataccacacaaataatattagat
aaaacagctactatagatgcattaaggaaattagccttagaggcagatgaaatattaata
ggtacagatccggatactgaaggagagaaaatcgcttgggatatttaccttgctttaaaa
ccatttaattctaacataaaaagagcagaatttcatgaagttactagaaaagctatcctc
caagcaatcaataatccaagaccatttaacgtaaatttagttaaatctcaaatagttagg
agaatagaagatagatggattggatttaaactttcaactaaattacaagaagatttctgg
aaagaatattgtaagaactataattgtaaaagcgaagaaaataagaatttaagtgctgga
agagtccaatcaccagtacttaattggatagtaaatagatatgacgagtataatgcaaat
aaaacaaaaatatattatggtagtatcaaaggcatagacgaacttaaattttatgtattc
aaacaaaatgaaaaaataaggaaaaacgctaatatatacgtaaaaatcattaacacaaaa
gtattagaagaagaaattaatccactaccaccttatactacagataccttactttatgat
gccaatcaattttatggaatctcagcatctgaaacgatgaaaattgctcaagatcttttt
gagttaggacttataacctatcatagaacagatagtactagaatctctaacacaggaata
tcaatagctgaaggatatctaaaacaaatagctggagaaaactacactaaaatatttaag
ccgagaagctggggagagggaggtgcacatgaagcaataaggcctactagacctctagat
gtagaccaattaagacttcttgtcgatgaaggagagatagaattagctaaaaaaatcacg
agagcacatttccttatatacgacttaatatttagaagatttattacaagccaattagtt
cccctaaaagttattaaagagagaattgaatataaaatatgtgaagatagcaactgtaat
tctgaattaaaaactttacagaattattctgaatttatcacagatataaaacttcctatt
cagcttgactattctaaattcctatatcttcctactacaagaattattaaaaatagtatt
ataaagaaacttcaagaaacaaccggctcaacaaatgcggaactagtttctaaaatccaa
ctaactggttcattcgttaaaagtacagtaaatttgtatactcaagcggaattagtagcc
gaaatgaagagaaaagagattggaagacctagtacatacgctacgataattagcacaata
ttaaaaagaggatatgttattgaaagtaaaaaaactaagaagcttatcccgacacagtta
ggcaaagaagtaaataagtatttaaatcaaaagtttagtagttttgtatctgaggaaaga
acaagaaatcttttgcagttgatggatatggtagaacaaggtaaacaagattatatacaa
atattaaaggatatttattacgaaataaagagtattaggtga

DBGET integrated database retrieval system