KEGG   Sulfurisphaera tokodaii: STK_03760
Entry
STK_03760         CDS       T00062                                 
Name
(GenBank) ATPase
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sto03019]
    STK_03760
   03009 Ribosome biogenesis [BR:sto03009]
    STK_03760
   04131 Membrane trafficking [BR:sto04131]
    STK_03760
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sto04147]
    STK_03760
Messenger RNA biogenesis [BR:sto03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     STK_03760
Ribosome biogenesis [BR:sto03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control proteins
    STK_03760
Membrane trafficking [BR:sto04131]
 SNARE
  SNARE associated proteins
   Others
    STK_03760
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    STK_03760
Exosome [BR:sto04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   STK_03760
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N CDC48_2 RuvB_N AAA_16 AAA_5 AAA_2 TIP49 AAA_22 AAA_14 Vps4_C AAA_18 AAA_33 AAA_28 nSTAND3 IstB_IS21 RNA_helicase Mg_chelatase TsaE NACHT AAA_3 AAA_24 AAA_25 Zeta_toxin Parvo_NS1 ATPase_2 ABC_tran AAA_17 Bac_DnaA DUF815 DUF5906 AAA_7 TniB ATPase AFG1_ATPase AAA_19 Molydop_binding PhoH UFD1 ATP-synt_ab
Other DBs
NCBI-ProteinID: BAK54256
UniProt: F9VMV9
Position
391960..394203
AA seq 747 aa
MSQEVSLRVSEARQRDVGKKIARLSDYTMRKLGIETGDYIEIIGPNGSALAQAMPSYDIS
DDEIKIDGYIRKSIGVGIGDDVKVKKANVTPATKITLAPTQPIRFDRSFVEYVKDQLMNK
PLAKGETIPVPIYTGTLDFIVINTQPSNYVYVTESTNLEIREEPAKESELGGYPKVTWED
IGDLEEAKQKIREIVEWPLRHPELFQRLGIEPPKGILLYGPPGNGKTLLARALANEVGAS
FYTINGPEIMSKFYGESEQRLREIFEEAQKNAPAIIFIDEIDSIAPKREEVTGEVEKRVV
AQLLTLMDGIKGRGKVIVIGATNRPDAVDPALRRPGRFDREIEIRPPDTKGRKEILQVHT
RNMPLAEDVDLDKLAEITYGYTGADLAALAKEAAMNALRRFIAEKKINLEQERIPAEILK
ELKVTMQDFLEAMKSIQPTLLREVYVEVPKVHWNDIGGLEEVKQQLREAVEWPLRFSELF
NKSGITPPKGILLFGPPGTGKTMLAKAVATESGANFIAVRGPEILSKWVGESEKAIREIF
RKARQAAPTIIFFDEIDAIAPMRGLTTDSGVTERIVNQLLAEMDGIVPLNKVVVIAATNR
PDILDPALLRPGRFDRLIYVPPPDKRARAEILKVHTRNVPLAEDITLDELAEKTEGYTGA
DIEALVREATINAMRKIFNDCDKKAKDQCQNNVDCYNSKMRDCMNNAKVIVTKEDFNKAL
EVVKPSLTAADIQRYERLAKELKRSVL
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgagccaagaggtcagtctaagagtaagtgaagctaggcaaagagacgtaggaaaaaag
attgcaagattatcagattacacgatgagaaaacttgggattgaaactggagattacatt
gaaataataggtccaaatggttccgccctagctcaagctatgccttcttatgatatttct
gatgacgaaataaagattgatgggtatattaggaaatctataggagtggggatcggcgat
gatgtaaaggtaaagaaagctaatgtaactccagcaacaaagataactcttgcacctaca
cagccaataagatttgatagaagtttcgtagaatatgtgaaagaccaactaatgaataaa
ccgttggcaaagggagaaacaataccagtcccaatttacactggtacattagatttcata
gtaataaatactcaaccttcaaattatgtatatgttacagagtctacaaaccttgagata
agagaagaaccagctaaagaaagtgaattgggcggatatcctaaagtaacatgggaggat
ataggcgatttagaagaggctaaacaaaaaatcagagaaatagttgaatggcctttaagg
caccctgaattattccaaagattagggatcgaaccacctaaaggaatcttgctatatggt
cctccaggaaatggtaaaactttacttgctagggcattagctaatgaggttggagctagt
ttttatacaattaacggcccagaaattatgagtaaattctatggtgagagcgaacaaaga
ctaagagaaatatttgaagaggcacagaaaaatgccccagctataatatttattgacgaa
atagattctatcgcacctaaaagagaggaagttactggtgaagttgagaagagagttgta
gcacaactattaacattaatggacggaattaaaggtagaggaaaagtaatagtaataggt
gctacaaatagaccagatgcggtagatccagcactaagaaggcctggaagattcgatagg
gaaatagagattagacctccagatactaaaggaagaaaagaaatcctacaagtacataca
agaaatatgccattagcagaagatgtagatttagataaacttgcagaaattacatacgga
tatactggagcagatttagcagcattagcaaaagaagccgctatgaatgcgttaagaagg
tttatagctgagaaaaaaataaatcttgaacaagaaagaattcctgctgaaattttaaag
gaattaaaagttactatgcaagatttcttagaggctatgaaatctatacagccaactctc
cttagagaagtttatgttgaagttccaaaagttcattggaatgatattggtggtcttgaa
gaggttaaacaacagcttagggaagcggtagaatggcctttaagattttcagaactattt
aacaaaagcggaataactccgcctaagggtattttgttgtttggtcctcctggtactggt
aagactatgcttgctaaggctgttgctactgagagtggtgctaattttattgctgttcgt
ggtcctgaaatcttatcaaagtgggttggtgagagtgagaaggctattagggaaatattt
aggaaggctaggcaagcagcaccaacaataatattctttgatgaaatagatgcaatagca
ccaatgagaggactaacaacagacagtggcgtaacagaaagaatagtaaaccaactacta
gcagaaatggacgggattgtgcccctaaataaggttgtcgttattgctgctactaatagg
cctgatattcttgatcctgctttgttgaggcctggtaggtttgataggttgatttatgtt
cctccgccagataagagggctagggctgagattttgaaagttcatactaggaatgtgcca
ttagctgaagatattacattagacgagctagctgaaaaaacagaaggctacacaggtgca
gatattgaagctttggtaagagaagctacaattaatgctatgagaaagatattcaatgat
tgtgacaagaaagccaaagatcaatgtcagaataatgttgattgttataatagtaaaatg
agggattgtatgaataatgcaaaagttattgtaacaaaagaagattttaataaagcttta
gaagtagttaaaccaagtttaacagcagctgacatacaaagatatgaaagactagcaaaa
gaattaaagaggtcagtattatga

DBGET integrated database retrieval system