KEGG   Sulfurisphaera tokodaii: STK_04010
Entry
STK_04010         CDS       T00062                                 
Name
(GenBank) putative ATP-dependent DNA helicase
  KO
K03724  ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.13 5.6.2.4]
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sto03400]
    STK_04010
Enzymes [BR:sto01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.4  DNA 3'-5' helicase
     STK_04010
DNA repair and recombination proteins [BR:sto03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    STK_04010
SSDB
Motif
Pfam: DEAD Helicase_C DEAD_assoc Lhr_WH ResIII AAA_19 PrpR_N HypA DUF1451 TF_Zn_Ribbon
Other DBs
NCBI-ProteinID: BAB65382
UniProt: Q975L8
Position
411441..414176
AA seq 911 aa
MISVSHDFVNKLRELGYTSLTPIQKVAIPIILKGKNTLVIAPTGYGKTEAAVFPVFYKIY
TENSVPVSALYITPLRALNRDIELRLKKIGEKLGIKVRVRHGDSTESERRRVLLDPPQLL
LTTPETLLYLVINEKYRKLFENLKWIIIDELQEMLDEKRGYELLIVLERLKRISKNRIQF
IGLSATIGNIEIAKKYLGEEVEVAKIDTRKDIDISLTIPELKKEYVDLSVKLGLNPEIIA
RFKKIEEIVKNEKPVLIFTNVRETTEFLANELSKITQLKILTHHGSLSRDVRVEAEKDFR
EGNIDALVATSSLELGIDIGKINVVIQYMSPRQVIRLVQRIGRSGHSVNKLSKGYIIPSN
DIYDILECKAIVDKLKEGYLEKPLIEYKPYDVIAHEIAGMVLEGYSNPKEIFDIIRSVFL
FSDLTEEEFTEILDILESAKIIKREKDRISPSFRLWKYYYETNMIPDSLRDYLVIDHVTN
SKIGTLDEEFISALDENTVFVLGGKLWKVVTIEDGKVYVEQAQLKSGILPSWFGESIPVE
KEVALKVYEYINRIAKGEEIDLPKDTFNKLRDLVDNQLKRGYPLPSDKEILVEINHDLIV
IHSAFGTRGNNTLGAIISALLSRLKGIKANYRSDSYHIAIATVIPIYKDDIIKIVNMINS
LQEKDLEELLKIAIKESPQFKWKLLVEAERFGVIDKGKDIDISSTLLRPFIDTIVGEEAV
KELIVKNYDLSILSNELRKVSWKILEVPSFSPLAKEFLDKLLVFRSSEDKPIMLEVYKRK
LLSKEVKLICMVCGWNSNFNVSQVPPRCPKCGSVFLTVVDLQDNESIQIVKKAIKGEKLS
KKELKKLEELKRISSFYSYYNKYVAIGLSAPGVGVTNISKALEKLREGEDKYYEALLDLE
RRFIRTRKYWH
NT seq 2736 nt   +upstreamnt  +downstreamnt
atgataagtgtttctcacgattttgtaaataaacttagggaattaggatatacgagtctt
actccaatacaaaaagtagctatccctataattctaaagggtaaaaatactttagttata
gcacctacaggctatggaaaaaccgaggcagctgtttttccggtgttttataagatttat
accgaaaattcggtccctgtatcagcgttatatattaccccattaagagcgttaaacaga
gatattgagttaagattaaagaagataggagaaaaattaggtattaaggttagagtaaga
catggtgattcaactgaaagtgaacgtagaagagtactccttgatcccccacaactcctt
ttaacaacccctgaaactttattatatctagtaataaatgaaaaatatagaaaattattt
gaaaatttgaaatggattataattgatgaactccaagaaatgttagatgaaaaaagggga
tatgaattattaattgttttagaacgtttaaaaagaataagtaagaatcgaatacagttt
ataggtttgtctgcaactattggaaatatagaaatagcaaaaaagtatttaggagaagaa
gtagaagtagcaaaaattgatactagaaaagatattgatatttcattaacaatcccagaa
ctaaaaaaggaatatgtcgatttatccgttaagttaggattaaatccagagataatagca
agattcaaaaagatagaagaaatcgttaaaaacgagaagcctgttttaatttttacaaat
gttagagaaacaacagaattcttggccaatgaactttctaaaataacacagcttaaaatt
ttgacccatcatggctcattatctcgagacgtaagagttgaagctgaaaaagactttaga
gaaggtaacattgatgctttagtagctacatctagtttagagttaggaatagatataggt
aaaattaatgttgtaatacaatacatgtctccaagacaagtaatacggctagttcagaga
attgggagaagcggacactctgtgaataaattatctaaaggctatataataccatcaaat
gatatatatgatatattagaatgtaaggccattgtagataaattgaaggaaggatacctt
gaaaaaccactaatagaatataagccttatgatgtaattgctcacgaaatagcaggtatg
gtattggaaggatatagtaatcctaaagagatatttgatataataagaagtgttttccta
tttagtgatctgacagaagaagaatttactgaaatacttgatatattagaatctgctaaa
attataaaaagggagaaagataggatatctccttctttcaggctttggaagtattattat
gaaactaatatgatacctgactcattaagagattacttggttatagatcatgtaactaac
tctaagataggtactctggatgaagaatttatttctgcgctagatgaaaatacagtattt
gttttaggcgggaaactttggaaagtagttactattgaagacggaaaagtatatgttgaa
caagcacaattaaaaagtggtattttacctagctggtttggagaatcgatcccagtagaa
aaggaggttgcgttaaaagtatatgagtacataaacagaatagcgaaaggcgaagaaata
gatttacctaaagatacatttaataaattaagagatctagtagataatcaattaaaaaga
ggatatcctttgccatcagataaagagattttggttgaaataaatcatgacctaattgta
attcactcagcttttggaaccagaggaaataatacattaggcgcaataatttctgcttta
ctttctcgattaaaaggaataaaagctaactataggtctgattcgtatcacatagctata
gcaaccgtaataccaatatataaagatgatattataaaaattgtaaatatgataaattca
ttacaagaaaaagatttggaagaattattaaaaatagcaataaaagaaagtcctcaattt
aaatggaaattattagttgaagcagaaagatttggagttattgataagggtaaagatatt
gatatttcttctacattattgagaccatttatagatactatagttggagaagaggcagtt
aaggagcttattgttaagaactatgatttaagtatcttatcaaacgaactaagaaaagta
agctggaaaatattagaagtacccagtttttcacctctagctaaagaatttttagataaa
cttttagttttccgttctagtgaagataaaccaattatgctagaggtttataagagaaaa
ttattatcaaaagaggtaaaacttatctgtatggtttgtggatggaatagcaattttaat
gtgagtcaggtccctcctagatgtccaaaatgtggttctgtatttttgacagttgttgat
ttgcaagataatgaaagtattcaaatagttaaaaaagcaataaaaggtgaaaaattaagt
aaaaaagaactaaaaaaactagaggaattgaagagaatttcatcgttttattcttactat
aataaatatgtagcaataggtctttctgctcctggagtaggtgttactaatattagtaaa
gcgttagaaaaattgagagaaggagaagataagtattatgaagcgcttttagatctagag
agaaggtttataaggactcgaaaatactggcactaa

DBGET integrated database retrieval system