KEGG   Sulfurisphaera tokodaii: STK_04080
Entry
STK_04080         CDS       T00062                                 
Symbol
cmk
Name
(GenBank) putative cytidylate kinase
  KO
K00945  CMP/dCMP kinase [EC:2.7.4.25]
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto00240  Pyrimidine metabolism
sto01100  Metabolic pathways
sto01232  Nucleotide metabolism
Brite
KEGG Orthology (KO) [BR:sto00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    STK_04080 (cmk)
Enzymes [BR:sto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     STK_04080 (cmk)
SSDB
Motif
Pfam: Cytidylate_kin2 AAA_18 AAA_17 Cytidylate_kin SKI dNK CoaE ADK Rad17 AAA_33 nSTAND3 PRK AAA_28 AAA KTI12 ABC_tran DNMK NTPase_1 AAA_16 RNA_helicase AAA_22 RuvB_N AAA_14 Zeta_toxin ATPase_2 APS_kinase T2SSE AAA_5 AAA_24 Viral_helicase1 AAA_30 Mg_chelatase Sigma54_activ_2 AAA_29 CPT ParA NACHT
Other DBs
NCBI-ProteinID: BAB65393
UniProt: Q975K7
Position
complement(421421..421963)
AA seq 180 aa
MIIVISGPPGSGKSTVAKILSKNLSLKYISAGHIFRELAEKEGLSLLELNKKAEENFEID
KKIDREIFRIASTEKNIIIESHIGGWLLKDIADITVYLNASIEIRAMRIAKRDNIPFTKA
IEQIIEREESHSRRFLAYYGIDLSDLSVFDLVINTDNLQPDEISKIIEAYLNFMLAKNIH
NT seq 543 nt   +upstreamnt  +downstreamnt
atgattattgttataagcggtcctccaggtagtggaaagtctacagtagctaaaatcttg
tccaagaatctatccttgaaatatatttctgcagggcatatatttagagaattagctgaa
aaagagggattaagcttattagaacttaataaaaaagctgaagaaaattttgaaatagat
aagaaaattgatagagaaatttttagaatagcatctactgaaaagaatattattattgaa
tctcatataggaggttggttattaaaagatatagctgatattacagtatatttaaatgct
agcatagaaattagagctatgcgaattgcaaaacgtgataatattccttttactaaagca
atagaacaaatcattgagagagaagaaagtcattctagaagatttttagcttattatggt
attgatttatcagatttatctgtttttgatttagttataaatacagataatttacaacca
gatgaaatcagtaaaataatagaagcatacctcaattttatgttagcaaaaaatattcat
taa

DBGET integrated database retrieval system