KEGG   Sulfurisphaera tokodaii: STK_04730
Entry
STK_04730         CDS       T00062                                 
Symbol
rfcL
Name
(GenBank) replication factor C large subunit
  KO
K04800  replication factor C large subunit
Organism
sto  Sulfurisphaera tokodaii
Pathway
sto03030  DNA replication
Brite
KEGG Orthology (KO) [BR:sto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    STK_04730 (rfcL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sto03032]
    STK_04730 (rfcL)
DNA replication proteins [BR:sto03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    RFC (replication factor C)
     STK_04730 (rfcL)
SSDB
Motif
Pfam: AAA RuvB_N AAA_5 Rad17 nSTAND3 AAA_assoc_2 AAA_22 AAA_14 AAA_16 DUF815 ATPase_2 AAA_18 AAA_28 AAA_17 NB-ARC NACHT IstB_IS21 AAA_24 DNA_pol3_delta RNA_helicase AAA_25 Parvo_NS1 TniB AAA_33 RsgA_GTPase TsaE PPV_E1_C ATPase AAA_7 ABC_tran Mg_chelatase AAA_3 NTPase_1 TIP49 TIP49_C MMR_HSR1 AAA_29 Sigma54_activat AAA_21
Other DBs
NCBI-ProteinID: BAK54296
UniProt: Q975D4
Position
complement(474974..476296)
AA seq 440 aa
MPLQWFLKYRPKTLNEVENEEDAKKELVEWIESWLKGKPNYKAVLLYGPPGVGKTTLAEA
LARDYKLELFEMNASDSRNLNDIRTMAERASITGTIFGIKGKLILLDEVDGLNARADAGA
IDAILELINKTKYPIILTANDPWDPSLRPLRNAVKMIELKRLTKYPLKRILKKICEAEKI
TCEDEALDFIIEQSEGDARYAINMLQGVAEGYGRVTLDMAKNLVRRKDRELDPFEALRGV
FWAKYYWQAKSAVTDTQIDYELLMRWLDENIPLQYDNLEDVWRAYDALSRASLFLTRSKL
VGWDLLSYTFDLMGPGIAFASLEKKKPTYKAKWVKYQFPQYIQQLAKTKEIRDALDTLLR
KIGQAIHASKDKTLNDFLPAFIIYYRKYQEKLDKELELTEKEKDVIKLISSFYEGSKVEI
EEPEKKEPSKRRTTSYRRKS
NT seq 1323 nt   +upstreamnt  +downstreamnt
ttgccactacaatggtttctaaaatataggccaaagactctaaatgaagtagagaacgaa
gaagatgctaaaaaagaactagtggaatggatagaaagttggttaaagggaaaacctaat
tataaggccgtattgctctatggacctcccggagttggaaagacaacgttagctgaagca
ctagctagagattataaactcgaattatttgaaatgaatgctagtgattcaagaaattta
aatgatatcagaactatggctgaacgagcttctataacagggacaatcttcgggattaag
ggaaaattaatacttttagatgaggttgatggtttgaatgcaagagctgatgctggtgca
attgatgctattctagaacttattaataaaactaaatacccaataattttaacagctaac
gatccttgggacccttccttaagacctttaagaaatgctgtaaaaatgatagaattaaaa
aggttaactaaatacccattaaagagaatacttaagaaaatatgtgaagcagaaaagatt
acatgtgaggatgaagcattagattttataattgaacagtcagagggagacgctagatat
gctataaacatgttacaaggggttgcagaaggttatggtagagtaacattagatatggct
aaaaatttagttaggagaaaagatagagaattagatccttttgaagcattaagaggtgta
ttttgggctaaatattactggcaagctaaaagcgcagtaacagatactcagatagattac
gaacttttaatgagatggttagatgaaaatataccattgcaatatgataatttagaagat
gtatggagagcatatgatgctttatcaagagcttcattatttttaacaagatctaaatta
gttgggtgggatcttttatcctatacgtttgatctaatggggcctggtatagcttttgcc
tccttagagaagaaaaagcctacatataaggctaagtgggtcaagtatcagtttcctcag
tacattcaacagttagctaaaactaaagaaattagagacgctttagatacattactaaga
aagataggccaggctatacatgcctcaaaagataaaactcttaatgattttctaccagct
tttataatatattacagaaaataccaggaaaaactagataaggagctcgaacttaccgaa
aaagaaaaagatgttattaagttaatttcttcattctacgaaggaagtaaagtggaaata
gaagaaccagagaaaaaagaaccaagtaaaagaagaactacttcatatcgtcgtaagtct
taa

DBGET integrated database retrieval system