KEGG   Sulfurisphaera tokodaii: STK_05750
Entry
STK_05750         CDS       T00062                                 
Name
(GenBank) putative TATA box-binding protein-interacting protein
  KO
K07472  TBP-interacting protein
Organism
sto  Sulfurisphaera tokodaii
Brite
KEGG Orthology (KO) [BR:sto00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    STK_05750
SSDB
Motif
Pfam: TIP49 TIP49_C AAA RuvB_N AAA_22 AAA_16 AAA_7 AAA_5 Mg_chelatase IstB_IS21 AAA_19 bpMoxR AAA_28 Parvo_NS1 nSTAND3 DnaB_C Sigma54_activat AAA_2 AAA_18 AAA_25 AAA_17 PhoH RNA_helicase SLFN-g3_helicase TsaE ResIII AAA_33 AAA_11 ABC_tran ATPase Rad17 NACHT DUF815
Other DBs
NCBI-ProteinID: BAB65571
UniProt: Q974T6
Position
564452..565810
AA seq 452 aa
MAEIREIRKIERERASIHSHISGLGLDEKGKAKFKADGLVGQTEAREAAGIVVQLIKQGK
MAGKGVLFVGPPGTGKTALAVAIAKELGEDTPFTTMNASEVYSTELKKTEILTQAIRKSI
GVRIKQRRIVYEGVVKDVKLKVARSRLNPYAVMPREAQIVLATKDEEKTLNVGDSIAEQL
VQLNVKKGDVIWIDAQTGEVSKVGKAKGFEGAKTYDIETIRQVDIPTGPVKKEKETTITV
TLHDLDLNVAARNISITALFSFFTEREINSEIRESVDKLVKDMINRGEAELVPGVLFIDD
AHMLDIEAFSFLTKALEADLAPILILATNRGITKIRGTDIESPHGMPLDLLDRLLIIPTR
PYTADEIREILKIRADEIDVHLEEKALETLTKLGVEYSLRYSVQLLEPSYVIAQRNGRNV
IKEEDVLEASKLFSDFRRSVEYVKEYEKLLLK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggcagagattagagagataagaaagattgaacgcgaaagagcaagtattcatagtcat
atttctggattaggtttagatgaaaaaggaaaagccaaatttaaggctgatggtctagtt
gggcaaacagaagcacgtgaagctgcaggtattgtcgttcaacttatcaaacaaggtaaa
atggccggaaaaggggtactattcgtaggccctcctggaactggaaaaacggccttagct
gttgcaatagccaaagagcttggagaagacacaccctttactacaatgaatgcttctgaa
gtttattcgacagagttaaagaagacagaaatactcacacaagctattagaaaatcaata
ggcgttaggattaagcaaaggagaattgtttatgaaggtgtagtaaaggatgtaaaatta
aaagtagcaagaagtagattaaatccttatgctgttatgcctagagaagcacaaatagtt
ctagctactaaggatgaggagaaaacactaaatgtgggagatagcattgctgaacaacta
gttcaacttaatgtaaaaaagggagatgtaatatggatcgacgctcaaactggagaggta
agtaaagttggtaaggctaaggggtttgaaggagctaaaacttatgatatagaaactatt
agacaagttgatattcctactggcccggttaagaaggaaaaagaaaccacaataactgta
acattacatgatttagatttaaacgtagcagctagaaatatttctataacagcgttattt
agtttctttacagaaagagaaataaacagtgagataagagaaagtgtagataaattagta
aaagatatgataaataggggagaagctgaactcgtacctggtgtattatttattgatgat
gcacatatgttagatatagaagcattctcattcttaactaaagcattagaagctgaccta
gcaccaatattaattttagctactaatagaggtataacaaaaataaggggtaccgacata
gaatctccacacggtatgccactagatctactcgatagattactaataatacctacaaga
ccatatactgctgatgaaataagagaaattctaaaaataagagcagacgaaattgatgtt
catctagaagagaaagcgttagagactttaacgaagctaggcgtagaatatagtttaaga
tattccgtccagctccttgagccttcttatgtaattgcacaaagaaacggtagaaatgtg
ataaaagaagaagatgtactagaagcatcgaaattgttctcagatttcagaagaagtgtg
gaatatgttaaggaatacgagaaattactactaaaatga

DBGET integrated database retrieval system